DPCstruct | MC47510
Metacluster Properties and Pfam Annotations
| Number of structural domains | 7 |
|---|---|
| Mean domain length (aa) | 136 ± 19 aa |
| Standard deviation of domain lengths | 19.24 |
| Length coefficient of variation | 0.14 |
| Mean AlphaFold2 pLDDT confidence score | 87.24 |
| Mean fraction of residues predicted as intrinsically disordered | 0.46 |
| Mean length-normalized TM-Score | 0.75 |
| Mean intra-cluster local Distance Difference Test score | 0.75 |
| Mean intra-cluster sequence similarity (%) | 36.80 |
| Pfam Score | 100.00 |
| Assigned Pfam label(s) | CL0036 |
Seed Sequences
Each DPCstruct metacluster stores at most two representative sequences: the cluster center and the member with the highest pLDDT confidence score. When both point to the same domain, only one entry is shown.
| Protein ID | Range | Seed Sequence |
|---|---|---|
| A0A6L7Q5R4 | 385-508 | RTDFVRSALVVGLEEEMETGLNPVKLGIIASTDTHTATPGAVAEEDWRGAVSVESTPEERLQPGLLTSGIDGNAGGLAGVWAVENSR… |
| A0A812ZN77 | 350-478 | QTSFARQGLKIGLQLEKELGFNPLAFGQVAATDTHNANPGDAEEWDFVGKVGAVSSPATRRQRYNAEKPYTSTLGHHTSGGLAAVWA… |
| A0A836SJN8 | 131-305 | None |
| A0A165U8N6 | 201-339 | None |
| A0A7X3PL23 | 1-107 | None |
| A0A508A4E3 | 1-137 | None |
| A0A2U8HI52 | 17-157 | None |
3D Structure Viewer
A maximum of two representative PDB files is stored per metacluster: the cluster center or the highest-pLDDT member. You can switch from them when possible.
AlphaFold Confidence (pLDDT)
Very high (pLDDT > 90)
High (90 > pLDDT > 70)
Low (70 > pLDDT > 50)
Very low (pLDDT < 50)
pLDDT is a per-residue measure of local confidence.