DPCstruct | MC47509
Metacluster Properties and Pfam Annotations
| Number of structural domains | 197 |
|---|---|
| Mean domain length (aa) | 218 ± 43 aa |
| Standard deviation of domain lengths | 42.79 |
| Length coefficient of variation | 0.20 |
| Mean AlphaFold2 pLDDT confidence score | 79.90 |
| Mean fraction of residues predicted as intrinsically disordered | 0.28 |
| Mean length-normalized TM-Score | 0.53 |
| Mean intra-cluster local Distance Difference Test score | 0.63 |
| Mean intra-cluster sequence similarity (%) | 17.23 |
| Pfam Score | 100.00 |
| Assigned Pfam label(s) | PF00482 |
Seed Sequences
Each DPCstruct metacluster stores at most two representative sequences: the cluster center and the member with the highest pLDDT confidence score. When both point to the same domain, only one entry is shown.
| Protein ID | Range | Seed Sequence |
|---|---|---|
| A0A0G0BTX9 | 49-189 | RKDLAIFFRQLSVMLESRVPVVQSLSSLAVQTRKSNFKKIITEVSSLVQEGTPLSEALSNYPKIFDNFYVNLIKSGEVSGNISGTLN… |
| A0A3S3WM12 | 28-245 | WFLSALCAVALSAMVVLITGSWGGMLAGLLAPPAVWLMWRNYREARYRAAVDDSVPEAMQMIVRALRIGQPVGFAIHGAGRDLTGPL… |
| A0A3M1JHH1 | 62-356 | None |
| A0A1D9NXJ5 | 6-197 | None |
| A0A1Y4EYJ6 | 55-281 | None |
| A0A800BS56 | 36-254 | None |
| A0A3Q9WQU5 | 10-204 | None |
| A0A7K0V3Z4 | 1-155 | None |
| A0A349SXZ7 | 2-154 | None |
| A0A662UV16 | 156-445 | None |
3D Structure Viewer
A maximum of two representative PDB files is stored per metacluster: the cluster center or the highest-pLDDT member. You can switch from them when possible.
AlphaFold Confidence (pLDDT)
Very high (pLDDT > 90)
High (90 > pLDDT > 70)
Low (70 > pLDDT > 50)
Very low (pLDDT < 50)
pLDDT is a per-residue measure of local confidence.