DPCstruct | MC47506
Metacluster Properties and Pfam Annotations
| Number of structural domains | 10 |
|---|---|
| Mean domain length (aa) | 90 ± 10 aa |
| Standard deviation of domain lengths | 9.89 |
| Length coefficient of variation | 0.11 |
| Mean AlphaFold2 pLDDT confidence score | 90.83 |
| Mean fraction of residues predicted as intrinsically disordered | 0.22 |
| Mean length-normalized TM-Score | 0.67 |
| Mean intra-cluster local Distance Difference Test score | 0.86 |
| Mean intra-cluster sequence similarity (%) | 38.37 |
| Pfam Score | 0.00 |
| Assigned Pfam label(s) | UNKNOWN |
Seed Sequences
Each DPCstruct metacluster stores at most two representative sequences: the cluster center and the member with the highest pLDDT confidence score. When both point to the same domain, only one entry is shown.
| Protein ID | Range | Seed Sequence |
|---|---|---|
| A0A3B9GRZ0 | 5-87 | FDAYVGRLQMGTHIVTEDFVYPVDKHGREYGFGWSLLTTPERLLGREACQCKRTPEESHERILTHLSQLLPMATEQQIRKLIK |
| A0A1V4IUU6 | 108-200 | KNMGGFDKSQKYEFDAALNMLQMKMFVTISGEKYKLSKDGKQYGWPVTTFCRIEDFWGEEVFDLSCSIGFQEAVDKITEQILVLNPK… |
| A0A5Q5G9J3 | 1-69 | None |
| A0A350BXT5 | 1-76 | None |
| I5AXL3 | 147-236 | None |
| A0A3D2G0H8 | 16-110 | None |
| A0A1C6ABZ5 | 22-118 | None |
| A0A1G9JJJ1 | 63-160 | None |
| A0A1H4A052 | 45-142 | None |
| R7A701 | 1-99 | None |
3D Structure Viewer
A maximum of two representative PDB files is stored per metacluster: the cluster center or the highest-pLDDT member. You can switch from them when possible.
AlphaFold Confidence (pLDDT)
Very high (pLDDT > 90)
High (90 > pLDDT > 70)
Low (70 > pLDDT > 50)
Very low (pLDDT < 50)
pLDDT is a per-residue measure of local confidence.