DPCstruct | MC4750
Metacluster Properties and Pfam Annotations
| Number of structural domains | 13 |
|---|---|
| Mean domain length (aa) | 195 ± 24 aa |
| Standard deviation of domain lengths | 23.53 |
| Length coefficient of variation | 0.12 |
| Mean AlphaFold2 pLDDT confidence score | 81.53 |
| Mean fraction of residues predicted as intrinsically disordered | 0.16 |
| Mean length-normalized TM-Score | 0.44 |
| Mean intra-cluster local Distance Difference Test score | 0.57 |
| Mean intra-cluster sequence similarity (%) | 18.52 |
| Pfam Score | 100.00 |
| Assigned Pfam label(s) | CL0123 |
Seed Sequences
Each DPCstruct metacluster stores at most two representative sequences: the cluster center and the member with the highest pLDDT confidence score. When both point to the same domain, only one entry is shown.
| Protein ID | Range | Seed Sequence |
|---|---|---|
| A0A1V4DH49 | 1-184 | MYKNNLKNLMIERNISNNKLATETSISRQAISKIKNNEFHDISINVLTELLEYFDVTFDEFGTIYTRNECLQALLPDKGFTNKNLQL… |
| A0A2X0R1Y5 | 1-173 | MIINKLNLLLAERFIKASKLAKDTGIAQSTISKIVNNATSQIDYSTLDKICLYLKITPSDFFEYAPYQFVFKNFQNDGYTKNKESAH… |
| W7BVL9 | 1-188 | None |
| A0A5P0ZLC1 | 1-188 | None |
| A0A2X0S447 | 1-187 | None |
| A0A511W6M8 | 33-211 | None |
| A0A143YUC6 | 1-211 | None |
| A0A5R8LSD7 | 1-158 | None |
| V8BDK7 | 18-215 | None |
| A0A2T5Q614 | 7-259 | None |
3D Structure Viewer
A maximum of two representative PDB files is stored per metacluster: the cluster center or the highest-pLDDT member. You can switch from them when possible.
AlphaFold Confidence (pLDDT)
Very high (pLDDT > 90)
High (90 > pLDDT > 70)
Low (70 > pLDDT > 50)
Very low (pLDDT < 50)
pLDDT is a per-residue measure of local confidence.