DPCstruct | MC475
Metacluster Properties and Pfam Annotations
| Number of structural domains | 14 |
|---|---|
| Mean domain length (aa) | 121 ± 6 aa |
| Standard deviation of domain lengths | 6.19 |
| Length coefficient of variation | 0.05 |
| Mean AlphaFold2 pLDDT confidence score | 88.05 |
| Mean fraction of residues predicted as intrinsically disordered | 0.26 |
| Mean length-normalized TM-Score | 0.88 |
| Mean intra-cluster local Distance Difference Test score | 0.83 |
| Mean intra-cluster sequence similarity (%) | 34.72 |
| Pfam Score | 100.00 |
| Assigned Pfam label(s) | CL0131 |
Seed Sequences
Each DPCstruct metacluster stores at most two representative sequences: the cluster center and the member with the highest pLDDT confidence score. When both point to the same domain, only one entry is shown.
| Protein ID | Range | Seed Sequence |
|---|---|---|
| A0A2P4EZL8 | 2-122 | SRVEHLFARLSLALLWLLTGVVSLTAGQSIGVEVLTAAGVDRTLIVPLIWAGSLLDLALGLWLLSGWALRLCCALQLGVVISYSILL… |
| A0A7Y8FQN2 | 14-152 | YTAAPLASRLQGWPTAAQSSQRTIRPLMLAVLVLIWLGTAAVCVGPGYAWGLRIMAEAGVQGTWATVAVIAGAVCDGLLGLGLLVAR… |
| A0A286C891 | 45-165 | None |
| A0A385YXI9 | 3-122 | None |
| A0A510G8L0 | 94-210 | None |
| A0A2K9NHP9 | 448-567 | None |
| A0A2S0MDC2 | 12-133 | None |
| A0A258ZD11 | 19-143 | None |
| A0A484QYE7 | 74-187 | None |
| A0A5A8F2V1 | 114-233 | None |
3D Structure Viewer
A maximum of two representative PDB files is stored per metacluster: the cluster center or the highest-pLDDT member. You can switch from them when possible.
AlphaFold Confidence (pLDDT)
Very high (pLDDT > 90)
High (90 > pLDDT > 70)
Low (70 > pLDDT > 50)
Very low (pLDDT < 50)
pLDDT is a per-residue measure of local confidence.