DPCstruct | MC47499
Metacluster Properties and Pfam Annotations
| Number of structural domains | 713 |
|---|---|
| Mean domain length (aa) | 146 ± 30 aa |
| Standard deviation of domain lengths | 29.74 |
| Length coefficient of variation | 0.20 |
| Mean AlphaFold2 pLDDT confidence score | 89.96 |
| Mean fraction of residues predicted as intrinsically disordered | 0.28 |
| Mean length-normalized TM-Score | 0.57 |
| Mean intra-cluster local Distance Difference Test score | 0.51 |
| Mean intra-cluster sequence similarity (%) | 18.72 |
| Pfam Score | 98.28 |
| Assigned Pfam label(s) | CL0170- PF18979- CL0020- CL0244 |
Seed Sequences
Each DPCstruct metacluster stores at most two representative sequences: the cluster center and the member with the highest pLDDT confidence score. When both point to the same domain, only one entry is shown.
| Protein ID | Range | Seed Sequence |
|---|---|---|
| A0A7C7ACF4 | 133-288 | SIIVDLRYASNNNFMGFQIYPDNSRAYLRRETAVKLLQASEIFKKDGYYIKIWDAYRPLSAQKIMWEHSPLPGYIANPDNGSKHNRG… |
| A0A6I2FP22 | 2-104 | LAAAYSHAADAAREEGVTIWITSGYRTPAEQQAMWEDGIRKYGSPEAARQWVLPPEDSTHVSGKAIDVGPRAGAQWLEDNGNRWGLC… |
| A0A848UEX7 | 26-147 | None |
| A0A351CPF3 | 6-149 | None |
| W4CH36 | 2-112 | None |
| A0A2V7Y550 | 202-345 | None |
| A0A7Y4ZGZ9 | 80-251 | None |
| A0A7Y4ZH05 | 188-376 | None |
| A0A7Y4ZJY7 | 7-106 | None |
| A0A356K3G6 | 294-435 | None |
3D Structure Viewer
A maximum of two representative PDB files is stored per metacluster: the cluster center or the highest-pLDDT member. You can switch from them when possible.
AlphaFold Confidence (pLDDT)
Very high (pLDDT > 90)
High (90 > pLDDT > 70)
Low (70 > pLDDT > 50)
Very low (pLDDT < 50)
pLDDT is a per-residue measure of local confidence.