DPCstruct | MC47493
Metacluster Properties and Pfam Annotations
| Number of structural domains | 10 |
|---|---|
| Mean domain length (aa) | 193 ± 18 aa |
| Standard deviation of domain lengths | 18.19 |
| Length coefficient of variation | 0.09 |
| Mean AlphaFold2 pLDDT confidence score | 63.09 |
| Mean fraction of residues predicted as intrinsically disordered | 0.81 |
| Mean length-normalized TM-Score | 0.25 |
| Mean intra-cluster local Distance Difference Test score | 0.75 |
| Mean intra-cluster sequence similarity (%) | 28.54 |
| Pfam Score | 100.00 |
| Assigned Pfam label(s) | CL0306 |
Seed Sequences
Each DPCstruct metacluster stores at most two representative sequences: the cluster center and the member with the highest pLDDT confidence score. When both point to the same domain, only one entry is shown.
| Protein ID | Range | Seed Sequence |
|---|---|---|
| V9L988 | 1-220 | MDTKALTDEELKEHLMKYGITPGPIVASTRMVYEKKLLKLMGQGPSVPPLKQNGTGDLDQYSDSEEEDDFPPEGAAARVTVSESSYL… |
| A0A401NV34 | 29-252 | MDVTQLSNEELKEQLMKHGVTPGPIVATTRMVYEKKLLKLMGQGPAVPPLKQNGTGDVDQYSDSEEEDDFPPEGSTRTIIDSSYQRQ… |
| A0A6J2UZZ3 | 1-171 | None |
| A0A210Q1F3 | 103-282 | None |
| A0A2G8L4U2 | 139-324 | None |
| A0A6F9BJK2 | 1-205 | None |
| A0A1S3H8F1 | 41-210 | None |
| A0A4W5LN29 | 79-271 | None |
| A0A673CDB9 | 72-250 | None |
| A0A6P5LQ87 | 14-213 | None |
3D Structure Viewer
A maximum of two representative PDB files is stored per metacluster: the cluster center or the highest-pLDDT member. You can switch from them when possible.
AlphaFold Confidence (pLDDT)
Very high (pLDDT > 90)
High (90 > pLDDT > 70)
Low (70 > pLDDT > 50)
Very low (pLDDT < 50)
pLDDT is a per-residue measure of local confidence.