DPCstruct | MC4749
Metacluster Properties and Pfam Annotations
| Number of structural domains | 22 |
|---|---|
| Mean domain length (aa) | 132 ± 27 aa |
| Standard deviation of domain lengths | 27.19 |
| Length coefficient of variation | 0.21 |
| Mean AlphaFold2 pLDDT confidence score | 86.64 |
| Mean fraction of residues predicted as intrinsically disordered | 0.19 |
| Mean length-normalized TM-Score | 0.65 |
| Mean intra-cluster local Distance Difference Test score | 0.60 |
| Mean intra-cluster sequence similarity (%) | 18.75 |
| Pfam Score | 0.00 |
| Assigned Pfam label(s) | UNKNOWN |
Seed Sequences
Each DPCstruct metacluster stores at most two representative sequences: the cluster center and the member with the highest pLDDT confidence score. When both point to the same domain, only one entry is shown.
| Protein ID | Range | Seed Sequence |
|---|---|---|
| A0A2G2L0S6 | 20-117 | TYEPINCACGGKEFNLHSDDTEGGAYAVCLECKAEHDLENSRQYIEEAIFNICHCDNDRFEIGVGKAYYDDSTDTQWVYVGASCKAC… |
| U2Q352 | 1-157 | MEYPIPKHIKDFFKLVDINNNEFEAKGSIKCSCGSETFSVYQSNNKMIVKLICQKCNKKIIIFDEGRHGWNGFVCKDDFLDRSQLFE… |
| A0A351MZL9 | 78-241 | None |
| A0A1V5UPU0 | 106-210 | None |
| A0A518I1F1 | 90-264 | None |
| A0A518DAX7 | 21-135 | None |
| A0A524FSJ7 | 21-138 | None |
| A0A5D0V0B7 | 417-530 | None |
| A0A2N1Q9D5 | 2-147 | None |
| A0A522C340 | 16-145 | None |
3D Structure Viewer
A maximum of two representative PDB files is stored per metacluster: the cluster center or the highest-pLDDT member. You can switch from them when possible.
AlphaFold Confidence (pLDDT)
Very high (pLDDT > 90)
High (90 > pLDDT > 70)
Low (70 > pLDDT > 50)
Very low (pLDDT < 50)
pLDDT is a per-residue measure of local confidence.