DPCstruct | MC47486
Metacluster Properties and Pfam Annotations
| Number of structural domains | 24 |
|---|---|
| Mean domain length (aa) | 180 ± 18 aa |
| Standard deviation of domain lengths | 17.96 |
| Length coefficient of variation | 0.10 |
| Mean AlphaFold2 pLDDT confidence score | 81.48 |
| Mean fraction of residues predicted as intrinsically disordered | 0.19 |
| Mean length-normalized TM-Score | 0.82 |
| Mean intra-cluster local Distance Difference Test score | 0.76 |
| Mean intra-cluster sequence similarity (%) | 39.73 |
| Pfam Score | 100.00 |
| Assigned Pfam label(s) | PF11732 |
Seed Sequences
Each DPCstruct metacluster stores at most two representative sequences: the cluster center and the member with the highest pLDDT confidence score. When both point to the same domain, only one entry is shown.
| Protein ID | Range | Seed Sequence |
|---|---|---|
| A0A835RQ69 | 9-200 | LEYVVIERLAQGGREKLKVDGLNLSDWLQSLASFWGHLCKKYPSMELRGLFQYLVNQLKKGIGIELVLLQELIQQMANVQYTENMTE… |
| A0A287MBQ5 | 143-288 | YIVIERLAQGGRERVKDDGLNLSDWLQCLASFWGHLCKKHFSMELKCLFQYIVNQLKKGLGTELVVLEELIQQMANVQYTENMTDEQ… |
| F4NSU7 | 753-921 | None |
| A0A5K3FWX9 | 305-486 | None |
| A0A1I8GXX4 | 237-413 | None |
| A0A818MI63 | 4-200 | None |
| A0A180G634 | 78-254 | None |
| B2KI97 | 611-780 | None |
| A0A6J0YTY1 | 607-820 | None |
| A0A1I8FUA8 | 513-689 | None |
3D Structure Viewer
A maximum of two representative PDB files is stored per metacluster: the cluster center or the highest-pLDDT member. You can switch from them when possible.
AlphaFold Confidence (pLDDT)
Very high (pLDDT > 90)
High (90 > pLDDT > 70)
Low (70 > pLDDT > 50)
Very low (pLDDT < 50)
pLDDT is a per-residue measure of local confidence.