DPCstruct | MC47483
Metacluster Properties and Pfam Annotations
| Number of structural domains | 8 |
|---|---|
| Mean domain length (aa) | 92 ± 6 aa |
| Standard deviation of domain lengths | 5.87 |
| Length coefficient of variation | 0.06 |
| Mean AlphaFold2 pLDDT confidence score | 69.89 |
| Mean fraction of residues predicted as intrinsically disordered | 0.26 |
| Mean length-normalized TM-Score | 0.69 |
| Mean intra-cluster local Distance Difference Test score | 0.80 |
| Mean intra-cluster sequence similarity (%) | 47.13 |
| Pfam Score | 0.00 |
| Assigned Pfam label(s) | UNKNOWN |
Seed Sequences
Each DPCstruct metacluster stores at most two representative sequences: the cluster center and the member with the highest pLDDT confidence score. When both point to the same domain, only one entry is shown.
| Protein ID | Range | Seed Sequence |
|---|---|---|
| A0A653D296 | 1-101 | MEFCPHGTRLDCERNGILECKKLHFKKILQKHTDESLGDCSFLNTCFHMDTCKYVHYEVDRLSTSEDKPNIPSGPVVRVESTTLYPP… |
| A0A7I8IZE3 | 258-345 | FKTKGGSQLKEYCSNLTKEDCRRQSGSYIACEKVHFRRIIAPHTDTNLGDCSFLDTCRHMKTCKYVHYELDPTPDVSPLMMGAVSMAP |
| A0A0N1IQY4 | 34-136 | None |
| A0A1V9ZCA7 | 84-175 | None |
| Q8I6Z2 | 454-544 | None |
| A0A2P5Y913 | 346-433 | None |
| A0A388LSN1 | 285-372 | None |
| A0A830CTI7 | 52-138 | None |
3D Structure Viewer
A maximum of two representative PDB files is stored per metacluster: the cluster center or the highest-pLDDT member. You can switch from them when possible.
AlphaFold Confidence (pLDDT)
Very high (pLDDT > 90)
High (90 > pLDDT > 70)
Low (70 > pLDDT > 50)
Very low (pLDDT < 50)
pLDDT is a per-residue measure of local confidence.