DPCstruct | MC47481
Metacluster Properties and Pfam Annotations
| Number of structural domains | 31 |
|---|---|
| Mean domain length (aa) | 142 ± 15 aa |
| Standard deviation of domain lengths | 15.44 |
| Length coefficient of variation | 0.11 |
| Mean AlphaFold2 pLDDT confidence score | 72.76 |
| Mean fraction of residues predicted as intrinsically disordered | 0.42 |
| Mean length-normalized TM-Score | 0.38 |
| Mean intra-cluster local Distance Difference Test score | 0.76 |
| Mean intra-cluster sequence similarity (%) | 50.14 |
| Pfam Score | 100.00 |
| Assigned Pfam label(s) | PF00010 |
Seed Sequences
Each DPCstruct metacluster stores at most two representative sequences: the cluster center and the member with the highest pLDDT confidence score. When both point to the same domain, only one entry is shown.
| Protein ID | Range | Seed Sequence |
|---|---|---|
| A0A835RHH1 | 2-131 | KNLQELVPNSNKNDRASMLDEIIDYVKFLQLQVKVLSISRLGAADADVPLITDVQTEDTGSLHVFPSQGEDLSESEENLAFEHEVVK… |
| A0A368UIH8 | 110-248 | RPRVRARRGQATDPHSIAERLRRERIAERIRALQELVPSVNKTDRAAMLDEIVDYVKFLRLQVKEEGGEGRNQPAWEKCSNDGTERQ… |
| A0A6A6LEB9 | 143-282 | None |
| A0A0K9QWS9 | 104-253 | None |
| A0A803PZQ6 | 18-163 | None |
| A0A0H3YB21 | 54-197 | None |
| A0A6V7PAE2 | 34-192 | None |
| A0A2Z6NAL0 | 167-298 | None |
| A0A7J9IKK1 | 76-222 | None |
| A0A2G5DI86 | 328-474 | None |
3D Structure Viewer
A maximum of two representative PDB files is stored per metacluster: the cluster center or the highest-pLDDT member. You can switch from them when possible.
AlphaFold Confidence (pLDDT)
Very high (pLDDT > 90)
High (90 > pLDDT > 70)
Low (70 > pLDDT > 50)
Very low (pLDDT < 50)
pLDDT is a per-residue measure of local confidence.