DPCstruct | MC4748
Metacluster Properties and Pfam Annotations
| Number of structural domains | 53 |
|---|---|
| Mean domain length (aa) | 70 ± 8 aa |
| Standard deviation of domain lengths | 7.64 |
| Length coefficient of variation | 0.11 |
| Mean AlphaFold2 pLDDT confidence score | 89.43 |
| Mean fraction of residues predicted as intrinsically disordered | 0.32 |
| Mean length-normalized TM-Score | 0.81 |
| Mean intra-cluster local Distance Difference Test score | 0.78 |
| Mean intra-cluster sequence similarity (%) | 30.04 |
| Pfam Score | 0.00 |
| Assigned Pfam label(s) | UNKNOWN |
Seed Sequences
Each DPCstruct metacluster stores at most two representative sequences: the cluster center and the member with the highest pLDDT confidence score. When both point to the same domain, only one entry is shown.
| Protein ID | Range | Seed Sequence |
|---|---|---|
| A0A5N8WIN0 | 3-70 | AEQFNALYEVGIPVFAYPGFRPEDDRNARRLVTRTRSVASVLGGHTDVVWVDGHSACIALSHVDVVSE |
| A0A395KQA3 | 2-76 | RPMPRTPEEMQVACDRFNRKYAVGDIIRCWPFARKGEPVERMVREPACILGGHTPVVYISGGGGCVSLDNVEMDR |
| G3IRB6 | 14-83 | None |
| A0A1R1S8L9 | 1-70 | None |
| A0A6A0AN04 | 1-105 | None |
| A0A530KP91 | 87-156 | None |
| A0A0T9NUG7 | 5-73 | None |
| I0H2V2 | 61-131 | None |
| A0A4S3LSU7 | 9-69 | None |
| A0A0Q7H7F3 | 11-83 | None |
3D Structure Viewer
A maximum of two representative PDB files is stored per metacluster: the cluster center or the highest-pLDDT member. You can switch from them when possible.
AlphaFold Confidence (pLDDT)
Very high (pLDDT > 90)
High (90 > pLDDT > 70)
Low (70 > pLDDT > 50)
Very low (pLDDT < 50)
pLDDT is a per-residue measure of local confidence.