DPCstruct | MC47479
Metacluster Properties and Pfam Annotations
| Number of structural domains | 39 |
|---|---|
| Mean domain length (aa) | 97 ± 12 aa |
| Standard deviation of domain lengths | 11.70 |
| Length coefficient of variation | 0.12 |
| Mean AlphaFold2 pLDDT confidence score | 81.22 |
| Mean fraction of residues predicted as intrinsically disordered | 0.17 |
| Mean length-normalized TM-Score | 0.79 |
| Mean intra-cluster local Distance Difference Test score | 0.78 |
| Mean intra-cluster sequence similarity (%) | 34.77 |
| Pfam Score | 100.00 |
| Assigned Pfam label(s) | CL0110 |
Seed Sequences
Each DPCstruct metacluster stores at most two representative sequences: the cluster center and the member with the highest pLDDT confidence score. When both point to the same domain, only one entry is shown.
| Protein ID | Range | Seed Sequence |
|---|---|---|
| A0A835RCY8 | 5-83 | TKKSKLELAKRNCEDIAMAFLVANETGAPPIWVKGKIIEMGSSGISSLGSHNERRTKCLDDFASVYGHMPLVSTNVKAI |
| A0A3P6NJY2 | 139-234 | FHKYFLYAYIFELPHVIYASIDELMNCEDIAMNMLIQQISEKAPYQVDTKTRFACPQCKDGLSRKKSHYIIRSACITNFIHSYGYDP… |
| A0A445B7R3 | 161-246 | None |
| A0A0K0DZB1 | 1154-1250 | None |
| A0A7R9L4V1 | 507-589 | None |
| A0A7R9A2J9 | 411-509 | None |
| A0A453SNB3 | 98-187 | None |
| E4XZ17 | 180-277 | None |
| A0A7J7X4M2 | 29-125 | None |
| A0A2I0S5M2 | 13-107 | None |
3D Structure Viewer
A maximum of two representative PDB files is stored per metacluster: the cluster center or the highest-pLDDT member. You can switch from them when possible.
AlphaFold Confidence (pLDDT)
Very high (pLDDT > 90)
High (90 > pLDDT > 70)
Low (70 > pLDDT > 50)
Very low (pLDDT < 50)
pLDDT is a per-residue measure of local confidence.