DPCstruct | MC4747
Metacluster Properties and Pfam Annotations
| Number of structural domains | 14 |
|---|---|
| Mean domain length (aa) | 86 ± 9 aa |
| Standard deviation of domain lengths | 8.88 |
| Length coefficient of variation | 0.10 |
| Mean AlphaFold2 pLDDT confidence score | 81.40 |
| Mean fraction of residues predicted as intrinsically disordered | 0.32 |
| Mean length-normalized TM-Score | 0.70 |
| Mean intra-cluster local Distance Difference Test score | 0.66 |
| Mean intra-cluster sequence similarity (%) | 23.59 |
| Pfam Score | 0.00 |
| Assigned Pfam label(s) | UNKNOWN |
Seed Sequences
Each DPCstruct metacluster stores at most two representative sequences: the cluster center and the member with the highest pLDDT confidence score. When both point to the same domain, only one entry is shown.
| Protein ID | Range | Seed Sequence |
|---|---|---|
| A0A2W4MQA2 | 9-99 | IVPGTLVRWTIHGMGGDQVREGRVVAYVPAGRDVRDVYPALRDLPPSRFRAELVSQLDRYLVAVQRPSGVVWLYAPPVRVVEVVRGP… |
| A0A7U6HU48 | 10-93 | FKVDQKVSWTSQARGAVTKKSGKVVAIKPVGITSSAYAKANFPNHAKMFDGHLDSRKVTLLVEVPNGNAKPKLYLPYPSTLKDE |
| A0A0U4WHI8 | 16-112 | None |
| E6SKG6 | 1-80 | None |
| A0A2P9H6N7 | 4-80 | None |
| A0A1C6I8P0 | 5-89 | None |
| M8D8Y2 | 1-68 | None |
| K1YD69 | 97-174 | None |
| A0A1U9LJL3 | 3-85 | None |
| A0A3D2GF41 | 2-96 | None |
3D Structure Viewer
A maximum of two representative PDB files is stored per metacluster: the cluster center or the highest-pLDDT member. You can switch from them when possible.
AlphaFold Confidence (pLDDT)
Very high (pLDDT > 90)
High (90 > pLDDT > 70)
Low (70 > pLDDT > 50)
Very low (pLDDT < 50)
pLDDT is a per-residue measure of local confidence.