DPCstruct | MC47464
Metacluster Properties and Pfam Annotations
| Number of structural domains | 42 |
|---|---|
| Mean domain length (aa) | 96 ± 12 aa |
| Standard deviation of domain lengths | 11.77 |
| Length coefficient of variation | 0.12 |
| Mean AlphaFold2 pLDDT confidence score | 91.89 |
| Mean fraction of residues predicted as intrinsically disordered | 0.19 |
| Mean length-normalized TM-Score | 0.81 |
| Mean intra-cluster local Distance Difference Test score | 0.81 |
| Mean intra-cluster sequence similarity (%) | 39.64 |
| Pfam Score | 100.00 |
| Assigned Pfam label(s) | CL0113 |
Seed Sequences
Each DPCstruct metacluster stores at most two representative sequences: the cluster center and the member with the highest pLDDT confidence score. When both point to the same domain, only one entry is shown.
| Protein ID | Range | Seed Sequence |
|---|---|---|
| A0A7Z1MXZ1 | 13-99 | LSSLTGFEALMRGCSVTVHGMPFYAGWGLTRDLAKSSPRRGRQLDVDRLVAAALILYPSYIDPVTRLPCGPELMVDRLASGSTPPMT |
| A0A4Y9JGZ2 | 2-86 | YCVTSQMGFEALLLGKPVAVFGLPWYAGWGVSDDRHAGVKTLQQQNRRAPRTLMQLFAAAYLQYSRYLNPNTGEAGTVFDVIGHL |
| A0A2K4MKR8 | 525-630 | None |
| A0A1L3LD71 | 13-103 | None |
| A0A2E6Y4D8 | 389-503 | None |
| A0A378PIE2 | 52-161 | None |
| A0A1H2EJS4 | 330-442 | None |
| A0A7W8UQW4 | 2-98 | None |
| A0A7V9T413 | 9-116 | None |
| A0A4Z0NKR1 | 531-635 | None |
3D Structure Viewer
A maximum of two representative PDB files is stored per metacluster: the cluster center or the highest-pLDDT member. You can switch from them when possible.
AlphaFold Confidence (pLDDT)
Very high (pLDDT > 90)
High (90 > pLDDT > 70)
Low (70 > pLDDT > 50)
Very low (pLDDT < 50)
pLDDT is a per-residue measure of local confidence.