DPCstruct | MC47456
Metacluster Properties and Pfam Annotations
| Number of structural domains | 13 |
|---|---|
| Mean domain length (aa) | 71 ± 6 aa |
| Standard deviation of domain lengths | 6.17 |
| Length coefficient of variation | 0.09 |
| Mean AlphaFold2 pLDDT confidence score | 86.86 |
| Mean fraction of residues predicted as intrinsically disordered | 0.20 |
| Mean length-normalized TM-Score | 0.74 |
| Mean intra-cluster local Distance Difference Test score | 0.74 |
| Mean intra-cluster sequence similarity (%) | 25.75 |
| Pfam Score | 0.00 |
| Assigned Pfam label(s) | UNKNOWN |
Seed Sequences
Each DPCstruct metacluster stores at most two representative sequences: the cluster center and the member with the highest pLDDT confidence score. When both point to the same domain, only one entry is shown.
| Protein ID | Range | Seed Sequence |
|---|---|---|
| A0A1E9IJN0 | 3-69 | KVKITKICQCCDRSFDFFLTVEQINKLYDGKLCIQQILPDLSPGDRELFISGICGECFDKIFLDSGE |
| A0A417CCA5 | 6-73 | IVKKECPMCGKTYFVKLTEVEYDQYKKYIAYGSLIQNALSNTSPTVREFLKTGYCPDCQKLLFGKCEQ |
| A0A7X3MMB6 | 30-110 | None |
| T5KE78 | 1-75 | None |
| A0A843GKR0 | 4-80 | None |
| A0A415SAM9 | 2-78 | None |
| A0A3B9ZNW1 | 1-62 | None |
| A0A661CXS5 | 36-108 | None |
| A0A1Y4AR53 | 79-153 | None |
| A0A6M5G7Z4 | 68-145 | None |
3D Structure Viewer
A maximum of two representative PDB files is stored per metacluster: the cluster center or the highest-pLDDT member. You can switch from them when possible.
AlphaFold Confidence (pLDDT)
Very high (pLDDT > 90)
High (90 > pLDDT > 70)
Low (70 > pLDDT > 50)
Very low (pLDDT < 50)
pLDDT is a per-residue measure of local confidence.