DPCstruct | MC47455
Metacluster Properties and Pfam Annotations
| Number of structural domains | 18 |
|---|---|
| Mean domain length (aa) | 110 ± 18 aa |
| Standard deviation of domain lengths | 18.44 |
| Length coefficient of variation | 0.17 |
| Mean AlphaFold2 pLDDT confidence score | 84.01 |
| Mean fraction of residues predicted as intrinsically disordered | 0.20 |
| Mean length-normalized TM-Score | 0.67 |
| Mean intra-cluster local Distance Difference Test score | 0.71 |
| Mean intra-cluster sequence similarity (%) | 27.34 |
| Pfam Score | 100.00 |
| Assigned Pfam label(s) | CL0063 |
Seed Sequences
Each DPCstruct metacluster stores at most two representative sequences: the cluster center and the member with the highest pLDDT confidence score. When both point to the same domain, only one entry is shown.
| Protein ID | Range | Seed Sequence |
|---|---|---|
| A0A1Q8C2I4 | 2-106 | TVTTERVKEILNSAEVTGCRLVIPQRLNRADYVAVNTVLTALGGSWSRANQAHVFPADPTDQLATVLADGALPRPARTTEGFVPTPA… |
| A0A238XKG1 | 9-126 | SHLTPATRAALEAAHIDGARVRLAEQLPVDDYADVAKVLAALGGLWSPAARATVFPDGTDAALLVKQVLAGGVVPLHPRTAEGWVRT… |
| A0A6P1IQZ3 | 252-365 | None |
| A0A239PF01 | 7-121 | None |
| A0A6P2FXA6 | 230-323 | None |
| A0A7W8URP8 | 1-111 | None |
| A0A193KJU9 | 256-400 | None |
| A0A3B9ZT54 | 4-137 | None |
| A0A6G7X2F8 | 3-98 | None |
| A0A2E8JSC7 | 2-77 | None |
3D Structure Viewer
A maximum of two representative PDB files is stored per metacluster: the cluster center or the highest-pLDDT member. You can switch from them when possible.
AlphaFold Confidence (pLDDT)
Very high (pLDDT > 90)
High (90 > pLDDT > 70)
Low (70 > pLDDT > 50)
Very low (pLDDT < 50)
pLDDT is a per-residue measure of local confidence.