DPCstruct | MC47450
Metacluster Properties and Pfam Annotations
| Number of structural domains | 76 |
|---|---|
| Mean domain length (aa) | 114 ± 19 aa |
| Standard deviation of domain lengths | 18.74 |
| Length coefficient of variation | 0.16 |
| Mean AlphaFold2 pLDDT confidence score | 81.68 |
| Mean fraction of residues predicted as intrinsically disordered | 0.22 |
| Mean length-normalized TM-Score | 0.74 |
| Mean intra-cluster local Distance Difference Test score | 0.74 |
| Mean intra-cluster sequence similarity (%) | 42.20 |
| Pfam Score | 98.08 |
| Assigned Pfam label(s) | CL0023- CL0223 |
Seed Sequences
Each DPCstruct metacluster stores at most two representative sequences: the cluster center and the member with the highest pLDDT confidence score. When both point to the same domain, only one entry is shown.
| Protein ID | Range | Seed Sequence |
|---|---|---|
| A0A3S4J820 | 1-96 | MSEMTPREIVSELNKHIIGQDNAKRSVAIALRNRWRRMQLDEELRHEVTPKNILMIGPTGVGKTEIARRLAKLANAPFIKVEATKFT… |
| A0A6B0Q5W3 | 6-79 | LTPRQVVSELDKYIVGQKEAKKSVAVALRNRYRRSKLPDDIRDEIVPKNILMIGPTGVGKTEIARRLARLVGAP |
| A0A2T7EB28 | 10-130 | None |
| H0UPN7 | 3-109 | None |
| F4PMA5 | 157-292 | None |
| A0A7R9YCI5 | 1-168 | None |
| A0A6J7VWL0 | 56-159 | None |
| A0A1A9VKD8 | 647-776 | None |
| A0A2G9PNA2 | 6-152 | None |
| A0A453G6J6 | 207-332 | None |
3D Structure Viewer
A maximum of two representative PDB files is stored per metacluster: the cluster center or the highest-pLDDT member. You can switch from them when possible.
AlphaFold Confidence (pLDDT)
Very high (pLDDT > 90)
High (90 > pLDDT > 70)
Low (70 > pLDDT > 50)
Very low (pLDDT < 50)
pLDDT is a per-residue measure of local confidence.