DPCstruct | MC4745
Metacluster Properties and Pfam Annotations
| Number of structural domains | 11 |
|---|---|
| Mean domain length (aa) | 264 ± 53 aa |
| Standard deviation of domain lengths | 53.37 |
| Length coefficient of variation | 0.20 |
| Mean AlphaFold2 pLDDT confidence score | 71.55 |
| Mean fraction of residues predicted as intrinsically disordered | 0.23 |
| Mean length-normalized TM-Score | 0.58 |
| Mean intra-cluster local Distance Difference Test score | 0.70 |
| Mean intra-cluster sequence similarity (%) | 27.98 |
| Pfam Score | 0.00 |
| Assigned Pfam label(s) | UNKNOWN |
Seed Sequences
Each DPCstruct metacluster stores at most two representative sequences: the cluster center and the member with the highest pLDDT confidence score. When both point to the same domain, only one entry is shown.
| Protein ID | Range | Seed Sequence |
|---|---|---|
| A0A168HZD0 | 61-412 | MRSRLTKKIKACLTKGDKLADLKKECLAMARIERGTVSNAEISAGFQLNTITNYLKNHSKANIDFWRDFVKSHFDTIAKEAQASIES… |
| A0A367K4H1 | 1-243 | MRSFIENRPGLTNVEEWRAVVDKHFDETLESLTGRLDSIMVSSSSSTTTNTVEEKQFHTFTAPFDKLIRKDIPLNIKEVILKKISFS… |
| I1C6F0 | 10-295 | None |
| A0A1X0RU83 | 1-212 | None |
| A0A168KA92 | 72-400 | None |
| A0A0B7N074 | 64-362 | None |
| A0A162TNV1 | 23-311 | None |
| A0A2G4T046 | 11-257 | None |
| A0A1X0R648 | 1-186 | None |
| A0A367JZ78 | 1-179 | None |
3D Structure Viewer
A maximum of two representative PDB files is stored per metacluster: the cluster center or the highest-pLDDT member. You can switch from them when possible.
AlphaFold Confidence (pLDDT)
Very high (pLDDT > 90)
High (90 > pLDDT > 70)
Low (70 > pLDDT > 50)
Very low (pLDDT < 50)
pLDDT is a per-residue measure of local confidence.