DPCstruct | MC47448
Metacluster Properties and Pfam Annotations
| Number of structural domains | 6 |
|---|---|
| Mean domain length (aa) | 57 ± 6 aa |
| Standard deviation of domain lengths | 6.15 |
| Length coefficient of variation | 0.11 |
| Mean AlphaFold2 pLDDT confidence score | 86.79 |
| Mean fraction of residues predicted as intrinsically disordered | 0.17 |
| Mean length-normalized TM-Score | 0.90 |
| Mean intra-cluster local Distance Difference Test score | 0.91 |
| Mean intra-cluster sequence similarity (%) | 50.27 |
| Pfam Score | 100.00 |
| Assigned Pfam label(s) | CL0037 |
Seed Sequences
Each DPCstruct metacluster stores at most two representative sequences: the cluster center and the member with the highest pLDDT confidence score. When both point to the same domain, only one entry is shown.
| Protein ID | Range | Seed Sequence |
|---|---|---|
| X8FLT1 | 20-75 | EWSKDDVLQAYLNIIYFGRGAYGISAASKAYFDKPVEQLTVSEGALLAALIRRPST |
| A0A3S4IP17 | 1-57 | MLNKNEILELYLNKIYLGYRAYGVGAAAQVYFGKTVDQLSLSEMAVIAGLPKAPSTF |
| A0A1V5ZKJ9 | 39-87 | None |
| A0A0F3IWI3 | 1-68 | None |
| A0A378VZW2 | 2-62 | None |
| A0A351Y3N9 | 55-106 | None |
3D Structure Viewer
A maximum of two representative PDB files is stored per metacluster: the cluster center or the highest-pLDDT member. You can switch from them when possible.
AlphaFold Confidence (pLDDT)
Very high (pLDDT > 90)
High (90 > pLDDT > 70)
Low (70 > pLDDT > 50)
Very low (pLDDT < 50)
pLDDT is a per-residue measure of local confidence.