DPCstruct | MC47446
Metacluster Properties and Pfam Annotations
| Number of structural domains | 11 |
|---|---|
| Mean domain length (aa) | 169 ± 14 aa |
| Standard deviation of domain lengths | 14.35 |
| Length coefficient of variation | 0.08 |
| Mean AlphaFold2 pLDDT confidence score | 88.01 |
| Mean fraction of residues predicted as intrinsically disordered | 0.41 |
| Mean length-normalized TM-Score | 0.69 |
| Mean intra-cluster local Distance Difference Test score | 0.70 |
| Mean intra-cluster sequence similarity (%) | 32.21 |
| Pfam Score | 75.00 |
| Assigned Pfam label(s) | CL0013- CL0021 |
Seed Sequences
Each DPCstruct metacluster stores at most two representative sequences: the cluster center and the member with the highest pLDDT confidence score. When both point to the same domain, only one entry is shown.
| Protein ID | Range | Seed Sequence |
|---|---|---|
| A0A3S4HRD1 | 1-161 | MVRQEMYNRYGESAYEDGYRIYTTITRKVQQAAQQAVRNNVLDYDMRHGYRGPANVLWKVGETAWDSKKITDTLKALPTYGPLLPAV… |
| A0A2X4TBM1 | 1-161 | MVRQEMYNRYGESAYEDGYRIYTTITRKVQQAAQQAVRNNVLNYDMRHGYRGPTNVLWKVGETAWDSKKITDTLKALPTYGPLLPAV… |
| A0A2G6CQ09 | 461-658 | None |
| A0A855HSM1 | 124-281 | None |
| A0A2X1JEA5 | 45-213 | None |
| A0A2X2BND2 | 99-269 | None |
| A0A4D7C476 | 58-241 | None |
| A0A258DG61 | 144-292 | None |
| A0A833NLI3 | 1-158 | None |
| A0A849DYL6 | 1-188 | None |
3D Structure Viewer
A maximum of two representative PDB files is stored per metacluster: the cluster center or the highest-pLDDT member. You can switch from them when possible.
AlphaFold Confidence (pLDDT)
Very high (pLDDT > 90)
High (90 > pLDDT > 70)
Low (70 > pLDDT > 50)
Very low (pLDDT < 50)
pLDDT is a per-residue measure of local confidence.