DPCstruct | MC47445
Metacluster Properties and Pfam Annotations
| Number of structural domains | 99 |
|---|---|
| Mean domain length (aa) | 304 ± 66 aa |
| Standard deviation of domain lengths | 66.36 |
| Length coefficient of variation | 0.22 |
| Mean AlphaFold2 pLDDT confidence score | 90.23 |
| Mean fraction of residues predicted as intrinsically disordered | 0.20 |
| Mean length-normalized TM-Score | 0.67 |
| Mean intra-cluster local Distance Difference Test score | 0.62 |
| Mean intra-cluster sequence similarity (%) | 23.66 |
| Pfam Score | 100.00 |
| Assigned Pfam label(s) | CL0036 |
Seed Sequences
Each DPCstruct metacluster stores at most two representative sequences: the cluster center and the member with the highest pLDDT confidence score. When both point to the same domain, only one entry is shown.
| Protein ID | Range | Seed Sequence |
|---|---|---|
| A0A3S4FWR6 | 10-346 | KNCGGLRPALYSAFRKKLGIGDFGDLKSMLVDVATRGGAFIGLNPIHALYPANPESASPYSPSSRRWLNVIYIDVNAVEDFRLSEEA… |
| A0A6D0EK58 | 2-214 | GIGDFGDLKSMLAEVGERGGAFIGLNPIHALYPANPESASPYSPSSRRWLNVIYIDVNALDDFKNSAEAQAWWALDTTQQALRQARE… |
| A0A7J0CPU0 | 4-231 | None |
| A0A446LYN1 | 255-534 | None |
| A0A820A0X2 | 5-315 | None |
| A0A426H5A2 | 100-350 | None |
| A0A258SMC3 | 5-217 | None |
| K8F3R6 | 451-796 | None |
| A0A287HI96 | 5-199 | None |
| A0A7C7HTH4 | 3-349 | None |
3D Structure Viewer
A maximum of two representative PDB files is stored per metacluster: the cluster center or the highest-pLDDT member. You can switch from them when possible.
AlphaFold Confidence (pLDDT)
Very high (pLDDT > 90)
High (90 > pLDDT > 70)
Low (70 > pLDDT > 50)
Very low (pLDDT < 50)
pLDDT is a per-residue measure of local confidence.