DPCstruct | MC4744
Metacluster Properties and Pfam Annotations
| Number of structural domains | 59 |
|---|---|
| Mean domain length (aa) | 286 ± 59 aa |
| Standard deviation of domain lengths | 58.81 |
| Length coefficient of variation | 0.21 |
| Mean AlphaFold2 pLDDT confidence score | 68.38 |
| Mean fraction of residues predicted as intrinsically disordered | 0.61 |
| Mean length-normalized TM-Score | 0.22 |
| Mean intra-cluster local Distance Difference Test score | 0.75 |
| Mean intra-cluster sequence similarity (%) | 20.97 |
| Pfam Score | 98.78 |
| Assigned Pfam label(s) | PF04695- PF17733 |
Seed Sequences
Each DPCstruct metacluster stores at most two representative sequences: the cluster center and the member with the highest pLDDT confidence score. When both point to the same domain, only one entry is shown.
| Protein ID | Range | Seed Sequence |
|---|---|---|
| A0A367JWY2 | 11-277 | QTKPEQTSTITLREDMLKPAVSFLTSPNVQSADKAKKIAFLQKKGLTQAEIDEAFKRAGDNNTHSLSTTTSANNNATNTIASRPMVP… |
| D8PQV9 | 1-266 | MSAPPRTDLIQNAVSFLADPKTQSSSLTQRIQFLEAKGLTPAEIDIAMRQANSTAAGPSYQPSFVPAGFGAYPPPRQWDWRDYFITA… |
| A0A2H3C2H6 | 1-293 | None |
| A0A438NJG0 | 1-427 | None |
| A0A4U0VK29 | 2-193 | None |
| A0A7R9Q6D6 | 28-202 | None |
| A0A4Y7NL66 | 14-253 | None |
| A0A1Y1VFM1 | 75-363 | None |
| B6JWW6 | 2-266 | None |
| A0A397SM37 | 100-388 | None |
3D Structure Viewer
A maximum of two representative PDB files is stored per metacluster: the cluster center or the highest-pLDDT member. You can switch from them when possible.
AlphaFold Confidence (pLDDT)
Very high (pLDDT > 90)
High (90 > pLDDT > 70)
Low (70 > pLDDT > 50)
Very low (pLDDT < 50)
pLDDT is a per-residue measure of local confidence.