DPCstruct | MC47436
Metacluster Properties and Pfam Annotations
| Number of structural domains | 4 |
|---|---|
| Mean domain length (aa) | 427 ± 48 aa |
| Standard deviation of domain lengths | 48.15 |
| Length coefficient of variation | 0.11 |
| Mean AlphaFold2 pLDDT confidence score | 71.42 |
| Mean fraction of residues predicted as intrinsically disordered | 0.44 |
| Mean length-normalized TM-Score | 0.32 |
| Mean intra-cluster local Distance Difference Test score | 0.64 |
| Mean intra-cluster sequence similarity (%) | 19.59 |
| Pfam Score | 87.50 |
| Assigned Pfam label(s) | PF02187- PF08580 |
Seed Sequences
Each DPCstruct metacluster stores at most two representative sequences: the cluster center and the member with the highest pLDDT confidence score. When both point to the same domain, only one entry is shown.
| Protein ID | Range | Seed Sequence |
|---|---|---|
| I4YJ41 | 1-393 | MMTTVEEIEFRLFELQELIHSNTENTLIEDKLHDIDDIVDDKTPIELVNEIEQLRYDINDKNWLIIYQSTSNQCKFMLNSLDKSYNY… |
| A0A4P9W233 | 101-469 | KDREKELRFRDACDEISTLLDRVREIIAAADPGSPAEQDLLRSAEDLLHTEAWPRAIALRQCAAETASSPSVLARYLETQRQIQDQI… |
| A0A367KHN6 | 397-851 | None |
| A0A1Q3E034 | 1-490 | None |
3D Structure Viewer
A maximum of two representative PDB files is stored per metacluster: the cluster center or the highest-pLDDT member. You can switch from them when possible.
AlphaFold Confidence (pLDDT)
Very high (pLDDT > 90)
High (90 > pLDDT > 70)
Low (70 > pLDDT > 50)
Very low (pLDDT < 50)
pLDDT is a per-residue measure of local confidence.