DPCstruct | MC47428
Metacluster Properties and Pfam Annotations
| Number of structural domains | 5 |
|---|---|
| Mean domain length (aa) | 174 ± 17 aa |
| Standard deviation of domain lengths | 16.84 |
| Length coefficient of variation | 0.10 |
| Mean AlphaFold2 pLDDT confidence score | 87.15 |
| Mean fraction of residues predicted as intrinsically disordered | 0.16 |
| Mean length-normalized TM-Score | 0.63 |
| Mean intra-cluster local Distance Difference Test score | 0.57 |
| Mean intra-cluster sequence similarity (%) | 17.26 |
| Pfam Score | 0.00 |
| Assigned Pfam label(s) | UNKNOWN |
Seed Sequences
Each DPCstruct metacluster stores at most two representative sequences: the cluster center and the member with the highest pLDDT confidence score. When both point to the same domain, only one entry is shown.
| Protein ID | Range | Seed Sequence |
|---|---|---|
| A0A2E9ITW0 | 1-194 | MDERSIAAAGFSFNDCVALLNFGAHATASRLVENHAVGSSEFDYSPELKKYKTTLNYFFEGGVGNAERALLDSAQEWAYDESTKTLY… |
| A0A7X6UMN6 | 1-191 | GFALIPDVVNPRKIEGGVGTKSGKFYYTGDRPERWLDEKGLHLHGYWFYDWADQRMFVDEIDTERKIISLHKPSTHSYGIRKNRRFA… |
| A0A6A5BDG5 | 1-162 | None |
| A0A7W1UI96 | 1-171 | None |
| M5S9C3 | 4-153 | None |
3D Structure Viewer
A maximum of two representative PDB files is stored per metacluster: the cluster center or the highest-pLDDT member. You can switch from them when possible.
AlphaFold Confidence (pLDDT)
Very high (pLDDT > 90)
High (90 > pLDDT > 70)
Low (70 > pLDDT > 50)
Very low (pLDDT < 50)
pLDDT is a per-residue measure of local confidence.