DPCstruct | MC47410
Metacluster Properties and Pfam Annotations
| Number of structural domains | 9 |
|---|---|
| Mean domain length (aa) | 120 ± 14 aa |
| Standard deviation of domain lengths | 14.36 |
| Length coefficient of variation | 0.12 |
| Mean AlphaFold2 pLDDT confidence score | 86.01 |
| Mean fraction of residues predicted as intrinsically disordered | 0.17 |
| Mean length-normalized TM-Score | 0.70 |
| Mean intra-cluster local Distance Difference Test score | 0.66 |
| Mean intra-cluster sequence similarity (%) | 23.42 |
| Pfam Score | 0.00 |
| Assigned Pfam label(s) | UNKNOWN |
Seed Sequences
Each DPCstruct metacluster stores at most two representative sequences: the cluster center and the member with the highest pLDDT confidence score. When both point to the same domain, only one entry is shown.
| Protein ID | Range | Seed Sequence |
|---|---|---|
| A0A7T9Q9Z2 | 7-137 | LAIIAVLALVIIFFAIKYDERKRKRLIEKLFEGRTPLSKEEFYRTFYSETDIAENVVVKVLQILEEYLDCDFSRLHPTDSFSSNLKF… |
| A0A351KYY2 | 221-330 | FFEMAQQALIQRFAEREALTVEEIFSKYYAYRNFTQLELIRIWQEVTAILQLEPQKVRPQDRFDTELASLYLFPQKLADLDKYLAQK… |
| A0A1V4WQ43 | 37-168 | None |
| A0A3E0ND14 | 2-114 | None |
| A0A2T5LIF2 | 5-105 | None |
| A0A4Q3C5H1 | 1-137 | None |
| A0A7C9HS88 | 4-110 | None |
| A0A6M5YZ56 | 8-147 | None |
| S9S6A9 | 5-109 | None |
3D Structure Viewer
A maximum of two representative PDB files is stored per metacluster: the cluster center or the highest-pLDDT member. You can switch from them when possible.
AlphaFold Confidence (pLDDT)
Very high (pLDDT > 90)
High (90 > pLDDT > 70)
Low (70 > pLDDT > 50)
Very low (pLDDT < 50)
pLDDT is a per-residue measure of local confidence.