DPCstruct | MC4740
Metacluster Properties and Pfam Annotations
| Number of structural domains | 10 |
|---|---|
| Mean domain length (aa) | 73 ± 6 aa |
| Standard deviation of domain lengths | 6.12 |
| Length coefficient of variation | 0.08 |
| Mean AlphaFold2 pLDDT confidence score | 89.27 |
| Mean fraction of residues predicted as intrinsically disordered | 0.38 |
| Mean length-normalized TM-Score | 0.84 |
| Mean intra-cluster local Distance Difference Test score | 0.94 |
| Mean intra-cluster sequence similarity (%) | 65.72 |
| Pfam Score | 100.00 |
| Assigned Pfam label(s) | PF19938 |
Seed Sequences
Each DPCstruct metacluster stores at most two representative sequences: the cluster center and the member with the highest pLDDT confidence score. When both point to the same domain, only one entry is shown.
| Protein ID | Range | Seed Sequence |
|---|---|---|
| A0A4R3EZJ8 | 9-78 | PAGPVEFSVDLTGHEMTRRAHVMNALGAEWDPVEVMRGEEEAYDMLYSGLDAEQQRLYDSLVEAGVLPRR |
| A0A652LDR8 | 1-74 | MVDFTVDLTAQEAERQVLVLDAIGPHWDPLEVMNGEEAAYDLLYSGLDADQQRLYDELVASGVLPRRGGGHAPA |
| A0A429H5Q1 | 1-75 | None |
| A0A6H1LFI5 | 9-82 | None |
| A0A7K3E5D3 | 31-109 | None |
| A0A1L7GS83 | 1-67 | None |
| V6KKS9 | 1-79 | None |
| A0A1M5TSC6 | 3-62 | None |
| A0A7W7S4W0 | 1-80 | None |
| A0A838S4E3 | 13-79 | None |
3D Structure Viewer
A maximum of two representative PDB files is stored per metacluster: the cluster center or the highest-pLDDT member. You can switch from them when possible.
AlphaFold Confidence (pLDDT)
Very high (pLDDT > 90)
High (90 > pLDDT > 70)
Low (70 > pLDDT > 50)
Very low (pLDDT < 50)
pLDDT is a per-residue measure of local confidence.