DPCstruct | MC474
Metacluster Properties and Pfam Annotations
| Number of structural domains | 13 |
|---|---|
| Mean domain length (aa) | 88 ± 7 aa |
| Standard deviation of domain lengths | 7.32 |
| Length coefficient of variation | 0.08 |
| Mean AlphaFold2 pLDDT confidence score | 86.08 |
| Mean fraction of residues predicted as intrinsically disordered | 0.16 |
| Mean length-normalized TM-Score | 0.75 |
| Mean intra-cluster local Distance Difference Test score | 0.75 |
| Mean intra-cluster sequence similarity (%) | 24.90 |
| Pfam Score | 0.00 |
| Assigned Pfam label(s) | UNKNOWN |
Seed Sequences
Each DPCstruct metacluster stores at most two representative sequences: the cluster center and the member with the highest pLDDT confidence score. When both point to the same domain, only one entry is shown.
| Protein ID | Range | Seed Sequence |
|---|---|---|
| A0A0A5GG52 | 10-87 | PLGLTLKYDYIEIDIPNNYGHVNIVDVEKQQIILELFIDLNKQEVKKSGSLEGYSIKEDDLIMEITGNVTYFIEEGIS |
| A0A0A3J8H9 | 7-94 | KSNVGHTIFKTTGVRHKYPLIDLVKKQVTCVVVYQENTYMTVIVDVKNDTVSIQGNVDELGGLAMSKDDYIDMFKHQAKLFVDNNVSD |
| A0A0X9VD89 | 4-88 | None |
| A0A368YAQ0 | 28-119 | None |
| A0A318TPH3 | 23-117 | None |
| R8HFT8 | 1-97 | None |
| A0A1I5VB94 | 189-278 | None |
| A0A3D9HNP5 | 3-80 | None |
| A0A7M2QX35 | 3-94 | None |
| A0A494Z3V7 | 2-73 | None |
3D Structure Viewer
A maximum of two representative PDB files is stored per metacluster: the cluster center or the highest-pLDDT member. You can switch from them when possible.
AlphaFold Confidence (pLDDT)
Very high (pLDDT > 90)
High (90 > pLDDT > 70)
Low (70 > pLDDT > 50)
Very low (pLDDT < 50)
pLDDT is a per-residue measure of local confidence.