DPCstruct | MC47395
Metacluster Properties and Pfam Annotations
| Number of structural domains | 24 |
|---|---|
| Mean domain length (aa) | 183 ± 48 aa |
| Standard deviation of domain lengths | 48.00 |
| Length coefficient of variation | 0.26 |
| Mean AlphaFold2 pLDDT confidence score | 88.44 |
| Mean fraction of residues predicted as intrinsically disordered | 0.19 |
| Mean length-normalized TM-Score | 0.76 |
| Mean intra-cluster local Distance Difference Test score | 0.67 |
| Mean intra-cluster sequence similarity (%) | 25.51 |
| Pfam Score | 0.00 |
| Assigned Pfam label(s) | UNKNOWN |
Seed Sequences
Each DPCstruct metacluster stores at most two representative sequences: the cluster center and the member with the highest pLDDT confidence score. When both point to the same domain, only one entry is shown.
| Protein ID | Range | Seed Sequence |
|---|---|---|
| A0A2E2WUC4 | 21-167 | EESLPIFIYPWGSFKKKEIISNKSRDTSRFCGPSSDSFIEEEFNRTISLYNKIRKEGYKPWSNFNRHIGGTYLIKKNGLKKFIVLQG… |
| A0A2S0ULC6 | 124-348 | CLGLHSVAFPMSPRGQNPFVQTVRAMDKGLDTYAGSALYAYYERFRPATAAAAIGVSPQVAHPDLLRPASAATLPWDFRDPAAAQAF… |
| W8KU68 | 8-123 | None |
| A0A2E6HA17 | 33-236 | None |
| A0A3D1V1Q8 | 38-151 | None |
| A0A2P8HQ93 | 342-557 | None |
| A0A1C0B8R1 | 39-263 | None |
| A0A0M4TUC2 | 59-284 | None |
| F6DCW6 | 30-197 | None |
| A0A2W7D987 | 13-214 | None |
3D Structure Viewer
A maximum of two representative PDB files is stored per metacluster: the cluster center or the highest-pLDDT member. You can switch from them when possible.
AlphaFold Confidence (pLDDT)
Very high (pLDDT > 90)
High (90 > pLDDT > 70)
Low (70 > pLDDT > 50)
Very low (pLDDT < 50)
pLDDT is a per-residue measure of local confidence.