DPCstruct | MC47394
Metacluster Properties and Pfam Annotations
| Number of structural domains | 9 |
|---|---|
| Mean domain length (aa) | 50 ± 5 aa |
| Standard deviation of domain lengths | 4.83 |
| Length coefficient of variation | 0.10 |
| Mean AlphaFold2 pLDDT confidence score | 80.29 |
| Mean fraction of residues predicted as intrinsically disordered | 0.84 |
| Mean length-normalized TM-Score | 0.86 |
| Mean intra-cluster local Distance Difference Test score | 0.88 |
| Mean intra-cluster sequence similarity (%) | 61.68 |
| Pfam Score | 0.00 |
| Assigned Pfam label(s) | UNKNOWN |
Seed Sequences
Each DPCstruct metacluster stores at most two representative sequences: the cluster center and the member with the highest pLDDT confidence score. When both point to the same domain, only one entry is shown.
| Protein ID | Range | Seed Sequence |
|---|---|---|
| A0A3D9R1K6 | 1-53 | MPSADEIEAAKTPKGGWTRDQLARWGVPWPPPKGWRQQLIKTSEKRAEELDWS |
| A0A2A9K4F7 | 1-57 | MSDEPSTPSPDEVAAARTPAGGWTKAQLAAWGVPWPPPKGWRAELEEQWKALGRPSA |
| A0A5J6IFA7 | 5-54 | None |
| A0A428WCG8 | 17-64 | None |
| G7HXN1 | 167-218 | None |
| A0A1V0TZJ3 | 17-60 | None |
| A0A3R9WPN8 | 4-53 | None |
| A0A160PK42 | 310-349 | None |
| A0A222W159 | 174-226 | None |
3D Structure Viewer
A maximum of two representative PDB files is stored per metacluster: the cluster center or the highest-pLDDT member. You can switch from them when possible.
AlphaFold Confidence (pLDDT)
Very high (pLDDT > 90)
High (90 > pLDDT > 70)
Low (70 > pLDDT > 50)
Very low (pLDDT < 50)
pLDDT is a per-residue measure of local confidence.