DPCstruct | MC47389
Metacluster Properties and Pfam Annotations
| Number of structural domains | 18 |
|---|---|
| Mean domain length (aa) | 70 ± 5 aa |
| Standard deviation of domain lengths | 5.42 |
| Length coefficient of variation | 0.08 |
| Mean AlphaFold2 pLDDT confidence score | 70.26 |
| Mean fraction of residues predicted as intrinsically disordered | 0.25 |
| Mean length-normalized TM-Score | 0.80 |
| Mean intra-cluster local Distance Difference Test score | 0.79 |
| Mean intra-cluster sequence similarity (%) | 47.55 |
| Pfam Score | 100.00 |
| Assigned Pfam label(s) | CL0123 |
Seed Sequences
Each DPCstruct metacluster stores at most two representative sequences: the cluster center and the member with the highest pLDDT confidence score. When both point to the same domain, only one entry is shown.
| Protein ID | Range | Seed Sequence |
|---|---|---|
| A0A2U1VLQ0 | 1-80 | MRTTDETLASLPAPDTRRWVSSRKQAVVLAVRTGTLSMTEACDRYGLSVEEFLSWDALFSRGGRRALRVTKLREFRAAGP |
| A0A2A2K7Y6 | 175-233 | TLPPPSTTRWVVRRKAEVVAAVNGGLLTVDEVCTRYGLTVEEFAGWQRAIDRSGMPGLR |
| A0A558QTW2 | 41-112 | None |
| A0A349TYI5 | 11-80 | None |
| A0A420WGR1 | 176-246 | None |
| A0A355RDH5 | 9-80 | None |
| A0A1G3ICL7 | 24-91 | None |
| A0A7C2A6X1 | 28-97 | None |
| A0A024KGA5 | 1-59 | None |
| A0A3S2ZD34 | 40-111 | None |
3D Structure Viewer
A maximum of two representative PDB files is stored per metacluster: the cluster center or the highest-pLDDT member. You can switch from them when possible.
AlphaFold Confidence (pLDDT)
Very high (pLDDT > 90)
High (90 > pLDDT > 70)
Low (70 > pLDDT > 50)
Very low (pLDDT < 50)
pLDDT is a per-residue measure of local confidence.