DPCstruct | MC47388
Metacluster Properties and Pfam Annotations
| Number of structural domains | 17 |
|---|---|
| Mean domain length (aa) | 128 ± 8 aa |
| Standard deviation of domain lengths | 7.98 |
| Length coefficient of variation | 0.06 |
| Mean AlphaFold2 pLDDT confidence score | 69.22 |
| Mean fraction of residues predicted as intrinsically disordered | 0.17 |
| Mean length-normalized TM-Score | 0.74 |
| Mean intra-cluster local Distance Difference Test score | 0.82 |
| Mean intra-cluster sequence similarity (%) | 55.92 |
| Pfam Score | 100.00 |
| Assigned Pfam label(s) | PF05758 |
Seed Sequences
Each DPCstruct metacluster stores at most two representative sequences: the cluster center and the member with the highest pLDDT confidence score. When both point to the same domain, only one entry is shown.
| Protein ID | Range | Seed Sequence |
|---|---|---|
| A0A5D2DCD6 | 1-133 | MLLFQFPEWSEDLTDWNREMHVKCTYNGVQLSETEFPKNWLTDGIQIKILFPFCLKPWHRFKLQPSHKDPMKKKKGQKNDFCFLTVW… |
| A0A251VCZ1 | 89-199 | LLRQSPEWYEDFQDWNREIYLKCNYNGLQFSKTEFPKNWLIEGFQIKILYPFHLKPWHRSKLRLSDRDRKQQDDFDSCFLTVLGMET… |
| A0A6H0DNF4 | 236-369 | None |
| A0A499PA15 | 941-1070 | None |
| P0C262 | 496-606 | None |
| A0A1B1FC35 | 637-758 | None |
| A0A1L2BNU1 | 557-688 | None |
| A0A411K0A6 | 839-965 | None |
| A0A5D2G7K2 | 1-114 | None |
| A0A0H3W2S4 | 469-600 | None |
3D Structure Viewer
A maximum of two representative PDB files is stored per metacluster: the cluster center or the highest-pLDDT member. You can switch from them when possible.
AlphaFold Confidence (pLDDT)
Very high (pLDDT > 90)
High (90 > pLDDT > 70)
Low (70 > pLDDT > 50)
Very low (pLDDT < 50)
pLDDT is a per-residue measure of local confidence.