DPCstruct | MC4738
Metacluster Properties and Pfam Annotations
| Number of structural domains | 12 |
|---|---|
| Mean domain length (aa) | 138 ± 10 aa |
| Standard deviation of domain lengths | 9.50 |
| Length coefficient of variation | 0.07 |
| Mean AlphaFold2 pLDDT confidence score | 78.19 |
| Mean fraction of residues predicted as intrinsically disordered | 0.37 |
| Mean length-normalized TM-Score | 0.67 |
| Mean intra-cluster local Distance Difference Test score | 0.63 |
| Mean intra-cluster sequence similarity (%) | 28.08 |
| Pfam Score | 0.00 |
| Assigned Pfam label(s) | UNKNOWN |
Seed Sequences
Each DPCstruct metacluster stores at most two representative sequences: the cluster center and the member with the highest pLDDT confidence score. When both point to the same domain, only one entry is shown.
| Protein ID | Range | Seed Sequence |
|---|---|---|
| A0A7W7VZ33 | 333-458 | RVGAASQLAFAGAGPEIAQYLTDDQGQKHYKQRTFAGSSSVHDARHEFDSVTFVGTDQVFRLGGIRVEAFSGMKKDLYEHLVEGEIE… |
| A0A652KEP6 | 5-127 | GLTAFAGDGTATAQYLTKRQGQRHFTGLIHAATDSVQDAYVQLHGIDFVGTDHVFRLNRTRVEAFSGVAKDLFHHLENGQIERYRTE… |
| A0A1C4V6R6 | 34-171 | None |
| A0A235AAL9 | 17-167 | None |
| A0A7W7PVF7 | 202-331 | None |
| A0A419HNB4 | 70-209 | None |
| A0A6G2BCX4 | 107-246 | None |
| A0A4Q7UCZ6 | 136-286 | None |
| A0A6I5FBJ1 | 66-214 | None |
| A0A2U0H0Y0 | 127-269 | None |
3D Structure Viewer
A maximum of two representative PDB files is stored per metacluster: the cluster center or the highest-pLDDT member. You can switch from them when possible.
AlphaFold Confidence (pLDDT)
Very high (pLDDT > 90)
High (90 > pLDDT > 70)
Low (70 > pLDDT > 50)
Very low (pLDDT < 50)
pLDDT is a per-residue measure of local confidence.