DPCstruct | MC47373
Metacluster Properties and Pfam Annotations
| Number of structural domains | 8 |
|---|---|
| Mean domain length (aa) | 94 ± 5 aa |
| Standard deviation of domain lengths | 4.97 |
| Length coefficient of variation | 0.05 |
| Mean AlphaFold2 pLDDT confidence score | 79.16 |
| Mean fraction of residues predicted as intrinsically disordered | 0.31 |
| Mean length-normalized TM-Score | 0.85 |
| Mean intra-cluster local Distance Difference Test score | 0.86 |
| Mean intra-cluster sequence similarity (%) | 49.19 |
| Pfam Score | 100.00 |
| Assigned Pfam label(s) | PF04751 |
Seed Sequences
Each DPCstruct metacluster stores at most two representative sequences: the cluster center and the member with the highest pLDDT confidence score. When both point to the same domain, only one entry is shown.
| Protein ID | Range | Seed Sequence |
|---|---|---|
| A0A5P1F0Z2 | 184-274 | YEDEENIDDEGSGNHIEVAARWFDGLIYRDQSITKEVYSVHNIEYDRQELRKLVRQVQSIQEALLAEESDTKDDSKLTRAKKPLIRF… |
| A0A5N6N8C5 | 39-129 | YEDEDEGFGDHHDIATKWFDGLVNKDADITNEIYSLSTIDFDRQELRKLVRNFCSLQVSSARSAENEGEMDKKLLKAKKSIIRFLLT… |
| A0A7J9INA6 | 1-102 | None |
| A0A2G3CQG8 | 133-218 | None |
| A0A0K9QXC2 | 217-308 | None |
| A0A287H2F4 | 68-157 | None |
| A0A803N7Z5 | 85-183 | None |
| A0A7J6WHI9 | 99-195 | None |
3D Structure Viewer
A maximum of two representative PDB files is stored per metacluster: the cluster center or the highest-pLDDT member. You can switch from them when possible.
AlphaFold Confidence (pLDDT)
Very high (pLDDT > 90)
High (90 > pLDDT > 70)
Low (70 > pLDDT > 50)
Very low (pLDDT < 50)
pLDDT is a per-residue measure of local confidence.