DPCstruct | MC47372
Metacluster Properties and Pfam Annotations
| Number of structural domains | 47 |
|---|---|
| Mean domain length (aa) | 246 ± 47 aa |
| Standard deviation of domain lengths | 46.70 |
| Length coefficient of variation | 0.19 |
| Mean AlphaFold2 pLDDT confidence score | 80.29 |
| Mean fraction of residues predicted as intrinsically disordered | 0.21 |
| Mean length-normalized TM-Score | 0.65 |
| Mean intra-cluster local Distance Difference Test score | 0.71 |
| Mean intra-cluster sequence similarity (%) | 32.37 |
| Pfam Score | 99.02 |
| Assigned Pfam label(s) | PF20428- CL0036 |
Seed Sequences
Each DPCstruct metacluster stores at most two representative sequences: the cluster center and the member with the highest pLDDT confidence score. When both point to the same domain, only one entry is shown.
| Protein ID | Range | Seed Sequence |
|---|---|---|
| A0A0E0P0K4 | 32-272 | VLNKFKSDLDQSLRSGGGFAASALWDTTEVRGKLEHHIEAHATSVREKTLGCACWTCIVNLETGEKNSWACIRRLYRHATENAILAF… |
| A0A287UAS8 | 94-276 | HPAFETLIKHLHCTVLSKFKNDLEQLLRSGERFAASARHCAQSSSVEFEAGWRDAVVKHADWDATNSRNKLQQSVEVHTAGLRIAKL… |
| A0A540MIN5 | 117-297 | None |
| A0A6B9V479 | 6-248 | None |
| A0A834XED8 | 4-184 | None |
| A0A835LMD7 | 15-211 | None |
| A0A287QEG0 | 208-468 | None |
| A0A7J9EPZ6 | 116-350 | None |
| A0A7S4P8N9 | 16-253 | None |
| A0A540MIU6 | 172-419 | None |
3D Structure Viewer
A maximum of two representative PDB files is stored per metacluster: the cluster center or the highest-pLDDT member. You can switch from them when possible.
AlphaFold Confidence (pLDDT)
Very high (pLDDT > 90)
High (90 > pLDDT > 70)
Low (70 > pLDDT > 50)
Very low (pLDDT < 50)
pLDDT is a per-residue measure of local confidence.