DPCstruct | MC47371
Metacluster Properties and Pfam Annotations
| Number of structural domains | 5 |
|---|---|
| Mean domain length (aa) | 66 ± 2 aa |
| Standard deviation of domain lengths | 2.32 |
| Length coefficient of variation | 0.03 |
| Mean AlphaFold2 pLDDT confidence score | 71.29 |
| Mean fraction of residues predicted as intrinsically disordered | 0.30 |
| Mean length-normalized TM-Score | 0.67 |
| Mean intra-cluster local Distance Difference Test score | 0.83 |
| Mean intra-cluster sequence similarity (%) | 55.75 |
| Pfam Score | 0.00 |
| Assigned Pfam label(s) | UNKNOWN |
Seed Sequences
Each DPCstruct metacluster stores at most two representative sequences: the cluster center and the member with the highest pLDDT confidence score. When both point to the same domain, only one entry is shown.
| Protein ID | Range | Seed Sequence |
|---|---|---|
| A0A822ZDL2 | 1-67 | MIAAMANYLRYDIYDHLELTEVNANSELRKLLMKTTSKSIIVTEDIDCSINLTNRKKPVGRNYQTNK |
| A0A1E5UMU2 | 48-112 | IAAMANYLRFDIYDLDLTEVESNSDLRRLLIGMSNRSIIVAEDIDCSIEMKQREGHELKSAEGEK |
| A0A0A9PDP5 | 129-191 | None |
| A0A0D9X2R7 | 1-70 | None |
| A0A7C8YCP3 | 48-113 | None |
3D Structure Viewer
A maximum of two representative PDB files is stored per metacluster: the cluster center or the highest-pLDDT member. You can switch from them when possible.
AlphaFold Confidence (pLDDT)
Very high (pLDDT > 90)
High (90 > pLDDT > 70)
Low (70 > pLDDT > 50)
Very low (pLDDT < 50)
pLDDT is a per-residue measure of local confidence.