DPCstruct | MC4737
Metacluster Properties and Pfam Annotations
| Number of structural domains | 18 |
|---|---|
| Mean domain length (aa) | 155 ± 16 aa |
| Standard deviation of domain lengths | 16.03 |
| Length coefficient of variation | 0.10 |
| Mean AlphaFold2 pLDDT confidence score | 73.05 |
| Mean fraction of residues predicted as intrinsically disordered | 0.39 |
| Mean length-normalized TM-Score | 0.66 |
| Mean intra-cluster local Distance Difference Test score | 0.83 |
| Mean intra-cluster sequence similarity (%) | 38.83 |
| Pfam Score | 0.00 |
| Assigned Pfam label(s) | UNKNOWN |
Seed Sequences
Each DPCstruct metacluster stores at most two representative sequences: the cluster center and the member with the highest pLDDT confidence score. When both point to the same domain, only one entry is shown.
| Protein ID | Range | Seed Sequence |
|---|---|---|
| A0A358PT41 | 63-210 | RKEQEERKEALEKEALEKKESEQKMFISILETGNVKRNYFMEKINGTYQPSCPYESLAKNGVIHYKGVEFVCDTERNAICLGDMSNK… |
| A0A3B9D760 | 9-147 | GYTTLYGKIAGLGTQNGQTRGSSFREHIDGTEKKAPYQHLAQNGTITYKGVTFVCDTDRNRITLGDVTDRSKCLNISLKGGGCLMVN… |
| R7R0S0 | 17-196 | None |
| A0A3R6LLJ0 | 1-132 | None |
| R6ZR59 | 2-161 | None |
| A0A1H2WM38 | 7-164 | None |
| A0A4R1QUR4 | 7-201 | None |
| A0A1I4E5U0 | 5-148 | None |
| A0A1M6TBY6 | 43-173 | None |
| A0A7G9FTD9 | 25-178 | None |
3D Structure Viewer
A maximum of two representative PDB files is stored per metacluster: the cluster center or the highest-pLDDT member. You can switch from them when possible.
AlphaFold Confidence (pLDDT)
Very high (pLDDT > 90)
High (90 > pLDDT > 70)
Low (70 > pLDDT > 50)
Very low (pLDDT < 50)
pLDDT is a per-residue measure of local confidence.