DPCstruct | MC47369
Metacluster Properties and Pfam Annotations
| Number of structural domains | 17 |
|---|---|
| Mean domain length (aa) | 568 ± 62 aa |
| Standard deviation of domain lengths | 61.60 |
| Length coefficient of variation | 0.11 |
| Mean AlphaFold2 pLDDT confidence score | 75.44 |
| Mean fraction of residues predicted as intrinsically disordered | 0.31 |
| Mean length-normalized TM-Score | 0.38 |
| Mean intra-cluster local Distance Difference Test score | 0.65 |
| Mean intra-cluster sequence similarity (%) | 26.76 |
| Pfam Score | 79.55 |
| Assigned Pfam label(s) | CL0063- CL0221- CL0029 |
Seed Sequences
Each DPCstruct metacluster stores at most two representative sequences: the cluster center and the member with the highest pLDDT confidence score. When both point to the same domain, only one entry is shown.
| Protein ID | Range | Seed Sequence |
|---|---|---|
| H2Y735 | 17-585 | KRLNKKMRKIRMKLESDNLRVVEDPTPFVVIANAGVGNMVCSTELMDVLCQYGRCSLPVLCNKSYAIAEFQTEFEAKSMVENIQGYK… |
| A0A2A2KTG5 | 258-822 | LDGPKLRKRLGKSLEQLKRHDPSVEVADKPTQTLFVGNSSVMCGVSLEELEEIFTVYDGNCQFIVYPNKRTYSFVQFSSVEQSQKAC… |
| A0A814KT05 | 29-565 | None |
| A0A3M7RSN6 | 592-1191 | None |
| A0A7I8V483 | 4-583 | None |
| A0A5N3VP78 | 2-527 | None |
| A0A2A6CHB1 | 269-900 | None |
| A0A6P4ZCX8 | 1-693 | None |
| A0A0E9NJ85 | 50-540 | None |
| A0A0L8G7I8 | 1-580 | None |
3D Structure Viewer
A maximum of two representative PDB files is stored per metacluster: the cluster center or the highest-pLDDT member. You can switch from them when possible.
AlphaFold Confidence (pLDDT)
Very high (pLDDT > 90)
High (90 > pLDDT > 70)
Low (70 > pLDDT > 50)
Very low (pLDDT < 50)
pLDDT is a per-residue measure of local confidence.