DPCstruct | MC47362
Metacluster Properties and Pfam Annotations
| Number of structural domains | 120 |
|---|---|
| Mean domain length (aa) | 229 ± 48 aa |
| Standard deviation of domain lengths | 48.36 |
| Length coefficient of variation | 0.21 |
| Mean AlphaFold2 pLDDT confidence score | 91.03 |
| Mean fraction of residues predicted as intrinsically disordered | 0.20 |
| Mean length-normalized TM-Score | 0.54 |
| Mean intra-cluster local Distance Difference Test score | 0.53 |
| Mean intra-cluster sequence similarity (%) | 17.18 |
| Pfam Score | 100.00 |
| Assigned Pfam label(s) | PF07751 |
Seed Sequences
Each DPCstruct metacluster stores at most two representative sequences: the cluster center and the member with the highest pLDDT confidence score. When both point to the same domain, only one entry is shown.
| Protein ID | Range | Seed Sequence |
|---|---|---|
| A0A2A2K1U7 | 30-279 | TKPHATAAQRVAHLRSRGLIVARPNVAARKIDLVGYERLRIYFLSRRQLGVPNRPFQPGTTYQQILRLYECDGMLREACFAAVGQFE… |
| A0A4R1XBG5 | 2-178 | RLYTWNIAISGALWGGFHVLEISLRNALHARMSMLASREDWWSSISLHKLERRKIDAAVRSVAREKGPRATPGHVVAELTFGFWVAL… |
| A0A510JKC2 | 1-279 | None |
| A0A3R6TYL0 | 1-225 | None |
| A0A8A8KUH2 | 1-277 | None |
| F0Q051 | 8-272 | None |
| A0A519EE70 | 34-306 | None |
| A0A0M4NNI0 | 4-197 | None |
| A0A1S2I7H5 | 9-234 | None |
| A0A842JGN1 | 149-416 | None |
3D Structure Viewer
A maximum of two representative PDB files is stored per metacluster: the cluster center or the highest-pLDDT member. You can switch from them when possible.
AlphaFold Confidence (pLDDT)
Very high (pLDDT > 90)
High (90 > pLDDT > 70)
Low (70 > pLDDT > 50)
Very low (pLDDT < 50)
pLDDT is a per-residue measure of local confidence.