DPCstruct | MC4736
Metacluster Properties and Pfam Annotations
| Number of structural domains | 539 |
|---|---|
| Mean domain length (aa) | 81 ± 14 aa |
| Standard deviation of domain lengths | 13.59 |
| Length coefficient of variation | 0.17 |
| Mean AlphaFold2 pLDDT confidence score | 83.48 |
| Mean fraction of residues predicted as intrinsically disordered | 0.52 |
| Mean length-normalized TM-Score | 0.72 |
| Mean intra-cluster local Distance Difference Test score | 0.73 |
| Mean intra-cluster sequence similarity (%) | 22.66 |
| Pfam Score | 99.51 |
| Assigned Pfam label(s) | PF03793- CL0202 |
Seed Sequences
Each DPCstruct metacluster stores at most two representative sequences: the cluster center and the member with the highest pLDDT confidence score. When both point to the same domain, only one entry is shown.
| Protein ID | Range | Seed Sequence |
|---|---|---|
| A0A7V6FEU4 | 197-268 | LGPKIKRTKVPDVTGILHADAIAALRNVKLQNSFTEEYSDTVAEGLVISQSPVQDTEVDEDTVVNLVISLGP |
| A0A537X7W1 | 14-99 | AGSPVTIVVAKSVPQVAVPDVSGQTEAHAVKALSGAGLTVQLALSNVSDRAKEGVVLSQRPSGYATVRRGAATTVTVGRYLAPPPP |
| A0A355UY63 | 215-297 | None |
| A0A3M0XVU9 | 196-302 | None |
| H5WVJ9 | 221-289 | None |
| A0A415G837 | 40-116 | None |
| A0A355TSE1 | 748-822 | None |
| A0A559KEK2 | 331-408 | None |
| A0A7K1VQG7 | 25-112 | None |
| A0A3P1SAM4 | 239-310 | None |
3D Structure Viewer
A maximum of two representative PDB files is stored per metacluster: the cluster center or the highest-pLDDT member. You can switch from them when possible.
AlphaFold Confidence (pLDDT)
Very high (pLDDT > 90)
High (90 > pLDDT > 70)
Low (70 > pLDDT > 50)
Very low (pLDDT < 50)
pLDDT is a per-residue measure of local confidence.