DPCstruct | MC47355
Metacluster Properties and Pfam Annotations
| Number of structural domains | 7 |
|---|---|
| Mean domain length (aa) | 81 ± 6 aa |
| Standard deviation of domain lengths | 5.80 |
| Length coefficient of variation | 0.07 |
| Mean AlphaFold2 pLDDT confidence score | 88.38 |
| Mean fraction of residues predicted as intrinsically disordered | 0.28 |
| Mean length-normalized TM-Score | 0.86 |
| Mean intra-cluster local Distance Difference Test score | 0.89 |
| Mean intra-cluster sequence similarity (%) | 51.79 |
| Pfam Score | 0.00 |
| Assigned Pfam label(s) | UNKNOWN |
Seed Sequences
Each DPCstruct metacluster stores at most two representative sequences: the cluster center and the member with the highest pLDDT confidence score. When both point to the same domain, only one entry is shown.
| Protein ID | Range | Seed Sequence |
|---|---|---|
| A0A1Z8RNI2 | 1-80 | MQIKVYDDQDNPGGGFYAVMKCDQAAEVCPIVTGASAWVSLPYEDPKNADGTPLEALKYDERCRQISTEMLWLRSQAALS |
| A6G4I8 | 204-295 | RMGEGVEPMLAFSKTWEDESNPKEGFAAVMTCSQADAACPFVRGAALRVALPYDDPKAADDTPEEAGRYDERARQIATEMLYLFRAV… |
| A0A4S4NAS9 | 53-139 | None |
| A0A090Q9Y4 | 37-112 | None |
| A9DS95 | 72-154 | None |
| A0A7Y2JIH2 | 42-117 | None |
| A0A812P773 | 485-560 | None |
3D Structure Viewer
A maximum of two representative PDB files is stored per metacluster: the cluster center or the highest-pLDDT member. You can switch from them when possible.
AlphaFold Confidence (pLDDT)
Very high (pLDDT > 90)
High (90 > pLDDT > 70)
Low (70 > pLDDT > 50)
Very low (pLDDT < 50)
pLDDT is a per-residue measure of local confidence.