DPCstruct | MC47350
Metacluster Properties and Pfam Annotations
| Number of structural domains | 117 |
|---|---|
| Mean domain length (aa) | 153 ± 26 aa |
| Standard deviation of domain lengths | 26.30 |
| Length coefficient of variation | 0.17 |
| Mean AlphaFold2 pLDDT confidence score | 85.34 |
| Mean fraction of residues predicted as intrinsically disordered | 0.25 |
| Mean length-normalized TM-Score | 0.66 |
| Mean intra-cluster local Distance Difference Test score | 0.62 |
| Mean intra-cluster sequence similarity (%) | 22.05 |
| Pfam Score | 80.99 |
| Assigned Pfam label(s) | CL0290- PF18052- PF05189 |
Seed Sequences
Each DPCstruct metacluster stores at most two representative sequences: the cluster center and the member with the highest pLDDT confidence score. When both point to the same domain, only one entry is shown.
| Protein ID | Range | Seed Sequence |
|---|---|---|
| A0A0V1AF73 | 19-153 | SNIKPMNLDDDTYRPSLSQGLGIMAIAEYTSGCLIAVDRIVEDEENSDELVKMINDDMKAVLDLPTCVDPHLQDQLIILMALASGVS… |
| A0A3A0A0Y5 | 275-428 | TIPARGEFRQLQIASYASRELRERQVASRQASACQNRLGLRPAAVDMAHVETFSPGSVITAVAEYEQTRLGADALGERGKPSERVGR… |
| A0A1Y6LJA1 | 199-394 | None |
| A0A7V0VZZ5 | 19-157 | None |
| A0A2U1S0C3 | 195-349 | None |
| A0A401L0J9 | 217-405 | None |
| A0A815JWK5 | 214-384 | None |
| A0A6A5Y3F7 | 240-416 | None |
| A0A497I391 | 139-271 | None |
| A0A848A3U4 | 60-182 | None |
3D Structure Viewer
A maximum of two representative PDB files is stored per metacluster: the cluster center or the highest-pLDDT member. You can switch from them when possible.
AlphaFold Confidence (pLDDT)
Very high (pLDDT > 90)
High (90 > pLDDT > 70)
Low (70 > pLDDT > 50)
Very low (pLDDT < 50)
pLDDT is a per-residue measure of local confidence.