DPCstruct | MC47345
Metacluster Properties and Pfam Annotations
| Number of structural domains | 24 |
|---|---|
| Mean domain length (aa) | 436 ± 72 aa |
| Standard deviation of domain lengths | 72.02 |
| Length coefficient of variation | 0.17 |
| Mean AlphaFold2 pLDDT confidence score | 75.36 |
| Mean fraction of residues predicted as intrinsically disordered | 0.30 |
| Mean length-normalized TM-Score | 0.34 |
| Mean intra-cluster local Distance Difference Test score | 0.54 |
| Mean intra-cluster sequence similarity (%) | 13.16 |
| Pfam Score | 0.00 |
| Assigned Pfam label(s) | UNKNOWN |
Seed Sequences
Each DPCstruct metacluster stores at most two representative sequences: the cluster center and the member with the highest pLDDT confidence score. When both point to the same domain, only one entry is shown.
| Protein ID | Range | Seed Sequence |
|---|---|---|
| A0A1Y1UX95 | 2-326 | MSSIKLEEMKRNAIITHVHGLQEIKELYNKLRNTTNPKDIASYGQHIVNISKYQESANWQYKNILRQFPESVDILKVYVLFLTDVMN… |
| A0A5J4VXI3 | 11-391 | GSGSTQLGITFRIRFSKATKEHELSKAFLSQAYMHLSRENMDLEQIMNLIDNAIIHERESRYIYEDLMKQNPNSTTVLRGFGALLRD… |
| A0A1Y1VP89 | 203-719 | None |
| A0A5J4VLP0 | 74-517 | None |
| A0A5J4VSD6 | 23-377 | None |
| D2W0U3 | 3-455 | None |
| A2DH95 | 37-520 | None |
| A0A0L0T5C9 | 445-971 | None |
| D2W2S2 | 16-363 | None |
| A0A5J4WL96 | 3-458 | None |
3D Structure Viewer
A maximum of two representative PDB files is stored per metacluster: the cluster center or the highest-pLDDT member. You can switch from them when possible.
AlphaFold Confidence (pLDDT)
Very high (pLDDT > 90)
High (90 > pLDDT > 70)
Low (70 > pLDDT > 50)
Very low (pLDDT < 50)
pLDDT is a per-residue measure of local confidence.