DPCstruct | MC47344
Metacluster Properties and Pfam Annotations
| Number of structural domains | 37 |
|---|---|
| Mean domain length (aa) | 142 ± 30 aa |
| Standard deviation of domain lengths | 29.97 |
| Length coefficient of variation | 0.21 |
| Mean AlphaFold2 pLDDT confidence score | 77.55 |
| Mean fraction of residues predicted as intrinsically disordered | 0.31 |
| Mean length-normalized TM-Score | 0.73 |
| Mean intra-cluster local Distance Difference Test score | 0.65 |
| Mean intra-cluster sequence similarity (%) | 35.18 |
| Pfam Score | 0.00 |
| Assigned Pfam label(s) | UNKNOWN |
Seed Sequences
Each DPCstruct metacluster stores at most two representative sequences: the cluster center and the member with the highest pLDDT confidence score. When both point to the same domain, only one entry is shown.
| Protein ID | Range | Seed Sequence |
|---|---|---|
| A0A5J4VVE2 | 18-141 | ECLNYFRMNGDTQVQQELINNGYGRVMSITFCTAGGIGEELDKKIYYGLYHISWFIREQHEGRTYGQQSFQPLPLLARQTEEQLEEE… |
| A0A5J4UY03 | 134-289 | LHSLYTLNNYKINIHFSQEIDNQTFKVRSSSRWCLWYIQDCGDLSAHSELINARYVRSLVIAISTASGSGEEQDLEIIHGLDFISDF… |
| A0A5J4VKC1 | 2-192 | None |
| A0A5J4VNC4 | 152-295 | None |
| A0A5J4VRM5 | 1-100 | None |
| A0A5J4VSK4 | 6-117 | None |
| A0A5J4UHW3 | 22-158 | None |
| A0A5J4ULJ5 | 5-104 | None |
| A0A5J4UPM0 | 175-304 | None |
| A0A5J4UZI1 | 25-149 | None |
3D Structure Viewer
A maximum of two representative PDB files is stored per metacluster: the cluster center or the highest-pLDDT member. You can switch from them when possible.
AlphaFold Confidence (pLDDT)
Very high (pLDDT > 90)
High (90 > pLDDT > 70)
Low (70 > pLDDT > 50)
Very low (pLDDT < 50)
pLDDT is a per-residue measure of local confidence.