DPCstruct | MC47343
Metacluster Properties and Pfam Annotations
| Number of structural domains | 17 |
|---|---|
| Mean domain length (aa) | 218 ± 20 aa |
| Standard deviation of domain lengths | 19.79 |
| Length coefficient of variation | 0.09 |
| Mean AlphaFold2 pLDDT confidence score | 75.67 |
| Mean fraction of residues predicted as intrinsically disordered | 0.19 |
| Mean length-normalized TM-Score | 0.55 |
| Mean intra-cluster local Distance Difference Test score | 0.73 |
| Mean intra-cluster sequence similarity (%) | 45.06 |
| Pfam Score | 0.00 |
| Assigned Pfam label(s) | UNKNOWN |
Seed Sequences
Each DPCstruct metacluster stores at most two representative sequences: the cluster center and the member with the highest pLDDT confidence score. When both point to the same domain, only one entry is shown.
| Protein ID | Range | Seed Sequence |
|---|---|---|
| A0A5J4VV87 | 1-221 | MIITLKFEAVNDWADMTHFASLRDIQKSWNVGIEMSYAEFEKLKIKLVLDQQITNDGTIDKMDDEFAQVCIDGLKNLPIHNYPQPLN… |
| A0A5J4TF09 | 1-193 | MNDEIAQACVNGLKNLEIHNYPQPINMEVPLLNIFLGLYGITNEQISTEGMKNIRQFNKRTPNAEKNYGQAAFNGERKPNQWILTKI… |
| A0A5J4VMH5 | 236-447 | None |
| A0A5J4TY72 | 7-221 | None |
| A0A5J4V4G8 | 330-541 | None |
| A0A5J4UPT3 | 1-239 | None |
| A0A5J4UGA0 | 160-352 | None |
| A0A5J4U9Q2 | 74-311 | None |
| A0A5J4VR79 | 1-207 | None |
| A0A5J4VK96 | 42-252 | None |
3D Structure Viewer
A maximum of two representative PDB files is stored per metacluster: the cluster center or the highest-pLDDT member. You can switch from them when possible.
AlphaFold Confidence (pLDDT)
Very high (pLDDT > 90)
High (90 > pLDDT > 70)
Low (70 > pLDDT > 50)
Very low (pLDDT < 50)
pLDDT is a per-residue measure of local confidence.