DPCstruct | MC47340
Metacluster Properties and Pfam Annotations
| Number of structural domains | 8 |
|---|---|
| Mean domain length (aa) | 310 ± 8 aa |
| Standard deviation of domain lengths | 8.10 |
| Length coefficient of variation | 0.03 |
| Mean AlphaFold2 pLDDT confidence score | 67.20 |
| Mean fraction of residues predicted as intrinsically disordered | 0.37 |
| Mean length-normalized TM-Score | 0.44 |
| Mean intra-cluster local Distance Difference Test score | 0.65 |
| Mean intra-cluster sequence similarity (%) | 45.71 |
| Pfam Score | 0.00 |
| Assigned Pfam label(s) | UNKNOWN |
Seed Sequences
Each DPCstruct metacluster stores at most two representative sequences: the cluster center and the member with the highest pLDDT confidence score. When both point to the same domain, only one entry is shown.
| Protein ID | Range | Seed Sequence |
|---|---|---|
| A0A5J4V1S7 | 109-413 | KIVPDQMTPASDANPLSDGTVTAGTSAEYSRGDHIHPLNISTSVPISDTADGAVGTSVNYSRSDHSHHINISSTTPLQDNDGSVGTA… |
| A0A5J4VHU2 | 1-299 | MYDTNWCNSGDIVPDQLTPANDTVLLVDSAVGAAGISNEYSRGDHQHPLQVTSVLSSADTVTGEVGTTNTYARSDHTHPVNLSTDAP… |
| A0A5J4UZJ8 | 1-322 | None |
| A0A5J4VKS1 | 1-323 | None |
| A0A5J4WWW6 | 96-401 | None |
| A0A5J4WVM0 | 404-716 | None |
| A0A7Y4B7D7 | 209-513 | None |
| A0A5J4X1S5 | 1-306 | None |
3D Structure Viewer
A maximum of two representative PDB files is stored per metacluster: the cluster center or the highest-pLDDT member. You can switch from them when possible.
AlphaFold Confidence (pLDDT)
Very high (pLDDT > 90)
High (90 > pLDDT > 70)
Low (70 > pLDDT > 50)
Very low (pLDDT < 50)
pLDDT is a per-residue measure of local confidence.