DPCstruct | MC47339
Metacluster Properties and Pfam Annotations
| Number of structural domains | 9 |
|---|---|
| Mean domain length (aa) | 146 ± 9 aa |
| Standard deviation of domain lengths | 8.71 |
| Length coefficient of variation | 0.06 |
| Mean AlphaFold2 pLDDT confidence score | 73.28 |
| Mean fraction of residues predicted as intrinsically disordered | 0.33 |
| Mean length-normalized TM-Score | 0.70 |
| Mean intra-cluster local Distance Difference Test score | 0.79 |
| Mean intra-cluster sequence similarity (%) | 29.20 |
| Pfam Score | 0.00 |
| Assigned Pfam label(s) | UNKNOWN |
Seed Sequences
Each DPCstruct metacluster stores at most two representative sequences: the cluster center and the member with the highest pLDDT confidence score. When both point to the same domain, only one entry is shown.
| Protein ID | Range | Seed Sequence |
|---|---|---|
| A0A5J4VSZ3 | 111-260 | QGNSIGKQRISSEDGFQDESVTAKITTRANRDVLAQSIVEGADLFQRTLRNSGIEPVAVQIIIGNWETAWRRHCSGLGKLVKYLKEQ… |
| A0A5J4VHS1 | 1-156 | MVVATQKHINGEFIIGLQRGESDSGTENEEDIVETSSGEDNDFIGQKGEIGEALFKQCLQKSGLTSGSINSIIKSWRGSQGRHACSL… |
| A0A5J4UD87 | 211-354 | None |
| A0A5J4TKW0 | 48-184 | None |
| A0A5J4UG41 | 461-607 | None |
| A0A5J4UBA0 | 324-458 | None |
| A0A5J4WMH1 | 71-206 | None |
| A0A5J4W9H4 | 178-338 | None |
| A0A5J4W702 | 399-550 | None |
3D Structure Viewer
A maximum of two representative PDB files is stored per metacluster: the cluster center or the highest-pLDDT member. You can switch from them when possible.
AlphaFold Confidence (pLDDT)
Very high (pLDDT > 90)
High (90 > pLDDT > 70)
Low (70 > pLDDT > 50)
Very low (pLDDT < 50)
pLDDT is a per-residue measure of local confidence.