DPCstruct | MC47338
Metacluster Properties and Pfam Annotations
| Number of structural domains | 7 |
|---|---|
| Mean domain length (aa) | 158 ± 27 aa |
| Standard deviation of domain lengths | 27.31 |
| Length coefficient of variation | 0.17 |
| Mean AlphaFold2 pLDDT confidence score | 76.79 |
| Mean fraction of residues predicted as intrinsically disordered | 0.20 |
| Mean length-normalized TM-Score | 0.55 |
| Mean intra-cluster local Distance Difference Test score | 0.79 |
| Mean intra-cluster sequence similarity (%) | 48.83 |
| Pfam Score | 0.00 |
| Assigned Pfam label(s) | UNKNOWN |
Seed Sequences
Each DPCstruct metacluster stores at most two representative sequences: the cluster center and the member with the highest pLDDT confidence score. When both point to the same domain, only one entry is shown.
| Protein ID | Range | Seed Sequence |
|---|---|---|
| A0A5J4VT95 | 279-453 | MCSIHSVEFTYDTPPSLDRQNNVLPHTKDNCLPACVSCNIAHASRDSKITSLHIKMRSYVIKHNLPMTVSDERIYKLLRECITGGLA… |
| A0A5J4U0G7 | 1-186 | MCNARFTWKNRPTLDRIDNKLGHSKDNVLPCCLYCNTCKANRDVNQMRLMIQLRKYALFKQLPMTLTNDEGYQLLRNGITCGLSQVM… |
| A0A5J4THA9 | 34-151 | None |
| A0A5J4V804 | 193-373 | None |
| A0A5J4UJP8 | 427-597 | None |
| A0A5J4UPU3 | 40-196 | None |
| A0A5J4TQJ1 | 82-196 | None |
3D Structure Viewer
A maximum of two representative PDB files is stored per metacluster: the cluster center or the highest-pLDDT member. You can switch from them when possible.
AlphaFold Confidence (pLDDT)
Very high (pLDDT > 90)
High (90 > pLDDT > 70)
Low (70 > pLDDT > 50)
Very low (pLDDT < 50)
pLDDT is a per-residue measure of local confidence.