DPCstruct | MC4733
Metacluster Properties and Pfam Annotations
| Number of structural domains | 13 |
|---|---|
| Mean domain length (aa) | 456 ± 92 aa |
| Standard deviation of domain lengths | 92.04 |
| Length coefficient of variation | 0.20 |
| Mean AlphaFold2 pLDDT confidence score | 74.36 |
| Mean fraction of residues predicted as intrinsically disordered | 0.35 |
| Mean length-normalized TM-Score | 0.68 |
| Mean intra-cluster local Distance Difference Test score | 0.66 |
| Mean intra-cluster sequence similarity (%) | 24.06 |
| Pfam Score | 0.00 |
| Assigned Pfam label(s) | UNKNOWN |
Seed Sequences
Each DPCstruct metacluster stores at most two representative sequences: the cluster center and the member with the highest pLDDT confidence score. When both point to the same domain, only one entry is shown.
| Protein ID | Range | Seed Sequence |
|---|---|---|
| A0A423NG02 | 1-325 | MRLDASAPTEQTPLFWLPWGHLNKPPLVESVQLGWFHYPIVPVGSNRTPKVYFVQHPDFTPAGFEAFDQMLYTAPLLQPVATFRLGN… |
| A0A2Z4ZER6 | 9-410 | VLLGRDAEQNYRARLSTELIASGPRLEQVEGSLLWRLAHRAETDAAGSTLMITRRRPAEDEPSEVVAPKRQHTPSPPSEAAVESAPV… |
| A0A2N1EA20 | 862-1201 | None |
| A0A7Y8RPW5 | 302-959 | None |
| A0A423L1R4 | 166-635 | None |
| W8Q460 | 8-447 | None |
| A0A855LG12 | 16-500 | None |
| A0A2R7NGF3 | 107-646 | None |
| A0A7Y1P7S5 | 548-1071 | None |
| A0A5E7DDU5 | 156-599 | None |
3D Structure Viewer
A maximum of two representative PDB files is stored per metacluster: the cluster center or the highest-pLDDT member. You can switch from them when possible.
AlphaFold Confidence (pLDDT)
Very high (pLDDT > 90)
High (90 > pLDDT > 70)
Low (70 > pLDDT > 50)
Very low (pLDDT < 50)
pLDDT is a per-residue measure of local confidence.