DPCstruct | MC47322
Metacluster Properties and Pfam Annotations
| Number of structural domains | 13 |
|---|---|
| Mean domain length (aa) | 111 ± 16 aa |
| Standard deviation of domain lengths | 15.60 |
| Length coefficient of variation | 0.14 |
| Mean AlphaFold2 pLDDT confidence score | 91.25 |
| Mean fraction of residues predicted as intrinsically disordered | 0.25 |
| Mean length-normalized TM-Score | 0.88 |
| Mean intra-cluster local Distance Difference Test score | 0.82 |
| Mean intra-cluster sequence similarity (%) | 35.85 |
| Pfam Score | 100.00 |
| Assigned Pfam label(s) | CL0036 |
Seed Sequences
Each DPCstruct metacluster stores at most two representative sequences: the cluster center and the member with the highest pLDDT confidence score. When both point to the same domain, only one entry is shown.
| Protein ID | Range | Seed Sequence |
|---|---|---|
| A0A7V3SBD8 | 1-125 | MPVEIPVEKWTGKVREVTLGAGGRKKVTIGGNSTLPYLKFEGQPANPTRVAIEVQDTDPTGWSPVLRAAWGDALKDPATWAKKAAEF… |
| C0QAX8 | 1-117 | MGFEITKESYAGAIKGITIGKGDGAITVGGQTSYPFYQFEGEMPNKPVIAMEIWDMEPEEWPATVIEPFKDVLNDPAAWAKKCVEEY… |
| A0A381I6Q4 | 1-96 | None |
| A0A2H6JMJ9 | 581-691 | None |
| A0A0D2GCJ4 | 1-117 | None |
| A0A2I0QLN8 | 136-258 | None |
| A0A7V4K361 | 2-152 | None |
| A0A0F2JIR7 | 1-92 | None |
| T0D3F5 | 1-102 | None |
| A0A1F2P9B6 | 96-192 | None |
3D Structure Viewer
A maximum of two representative PDB files is stored per metacluster: the cluster center or the highest-pLDDT member. You can switch from them when possible.
AlphaFold Confidence (pLDDT)
Very high (pLDDT > 90)
High (90 > pLDDT > 70)
Low (70 > pLDDT > 50)
Very low (pLDDT < 50)
pLDDT is a per-residue measure of local confidence.